SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000013415 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000013415
Domain Number 1 Region: 546-577,717-791
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000138
Family Anti-sigma factor antagonist SpoIIaa 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000013415   Gene: ENSCPOG00000014887   Transcript: ENSCPOT00000015032
Sequence length 948
Comment pep:known_by_projection scaffold:cavPor3:scaffold_15:36362125:36420389:1 gene:ENSCPOG00000014887 transcript:ENSCPOT00000015032 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIHPEKSYQSSTSKHRPSSFLYKIKRDVYNEETFQQEHRSKFLSSGTLAENVSSRRHQVL
CNCTWHKFLRCMITIFPFLKWVCFYRWKDWLLGDLLAGLSVGFVQIPQGLALSLLTRQLV
PPLNVAFSAFCSSIVYVIFGSCHQMSIGPFFLMSALMINVLKHQPFNDGHLILGTFVPTD
FTAPFYIEKYNESLSVVAATTFLTGMIQLSMGVLGIGFMAMYLPEAVVSAYLAAAALHII
LSQLPCVFGVMIAFHAGPIAFFSNIINYCVALPKANSTSILLFLTAAVALRISKCLRMSF
NHYPIEFPMELILILGFAALANKINMATENSKLFIEMMPFSLVSPTLPDFSIIRYIVLQS
ISLSLVSSFLLIFLGRKIASFHNYRVNSNQDLIAIGLCNVISACFSSHVFTGAVARTMIQ
DKSGGRQQFASLVGAGVMLLLMVKVGRFFYELPNVILAAVILINVIPYLQVIYNLPGLWR
KDQFDCISWMVTFISTVFLGLDVGLVISLLFAFFIVTVRSHRTEVTCLGQVPHTNLYKSI
TDYRELIIIPGVQIFQCCNAITFINVYHLKSALLKELGMVSVPLEEEEIFGLFNESETSL
EREKICRCFCSCEDLEPPPRIAYTERFKYKEPDSSSVNLVHSSHLDPTSPSDSMLNGVEQ
ELSYVVPSTSQRLQEEPYENVERGWASSNSLQKNIPSLQDTTAGKMKLTTPYSDVALQPS
THTIILDFSLVHYVDCRGLVVLRQMCNAFQNANILVLITGCHSAVIREFEKCDFFDHGIT
KAHLFLTLHDAVLYALSRKAPDNSELSVDEGETVIQETYTESDKNDKPLYDKSRGFLDSS
TNTSYHLPKYRKPKDESLELDLDLYDIVEPKEEPQQMDLDMSLDRVLEPEAESELEIVSD
PQPERPPEPKSTPKASVYSRHLYQPIYQPAAPSTQPQPLPWRRSSEKR
Download sequence
Identical sequences ENSCPOP00000013415 10141.ENSCPOP00000013415 ENSCPOP00000013415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]