SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000013491 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCPOP00000013491
Domain Number - Region: 53-96
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.0291
Family Rubredoxin 0.031
Further Details:      
 
Domain Number - Region: 84-116
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.0392
Family Rubredoxin 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000013491   Gene: ENSCPOG00000014969   Transcript: ENSCPOT00000015115
Sequence length 129
Comment pep:known_by_projection scaffold:cavPor3:scaffold_80:6247785:6248207:-1 gene:ENSCPOG00000014969 transcript:ENSCPOT00000015115 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLPLFDLWKDYFNLSKVVLALIKSRSQRLEIEQRPSPGPQLGQRGLEPGTTLCNFCKHN
GESRHVYASHQLKTPEGVVLCPILRHYVCPLCGATGGQAHTLKYCPLNGNQQSLYRRSGR
NSAGRKAKH
Download sequence
Identical sequences ENSCPOP00000013491 10141.ENSCPOP00000013491 ENSCPOP00000013491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]