SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000013543 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000013543
Domain Number 1 Region: 134-171,251-296
Classification Level Classification E-value
Superfamily SET domain 0.00000014
Family Histone lysine methyltransferases 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000013543   Gene: ENSCPOG00000015025   Transcript: ENSCPOT00000015172
Sequence length 299
Comment pep:known_by_projection scaffold:cavPor3:scaffold_29:5010948:5020907:-1 gene:ENSCPOG00000015025 transcript:ENSCPOT00000015172 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGRLLRGLWQRWSRYKYRFVPWIALNLSHNPRTLRYVPEESKDKVISDEDVLETLLEVF
QALFLNDLNKQSDILTLLPQSVKSKYQDLLALQHHRVNLLENRHQLQNIFKPEEILYKTL
GFSVARATSSLISAGRGVFVTKGLVPKGAVVSMYPGTVYQKYEPIFFQSIGNPFIFRCLD
GTLIDGNDKGISKVVYRSCSGRDRLGPLKMSDATWLTSEIHNPLAIGQYVNNCSNDRAAN
VCYQEFEVPAVFPIELKQYLPNIAYSYDTQSPLRCVVLVALRDIKQGEELFSNYYTIVS
Download sequence
Identical sequences H0VSE3
XP_003470295.1.53824 ENSCPOP00000013543 10141.ENSCPOP00000013543 ENSCPOP00000013543

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]