SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000013737 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000013737
Domain Number 1 Region: 155-187
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00000216
Family Ran binding protein zinc finger-like 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000013737   Gene: ENSCPOG00000015241   Transcript: ENSCPOT00000015388
Sequence length 194
Comment pep:novel scaffold:cavPor3:scaffold_46:13329284:13329868:1 gene:ENSCPOG00000015241 transcript:ENSCPOT00000015388 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EASATGGGKEGEEEMDVISTAPEEDLSDSVLQFLGVVQQKNYTSATEREGNTRPIEKPTL
CLSGTPKAASTASPDPLPVQLPASFTYSYSSPLSCFPAASSPPPLAATITAPVPPEVSSH
YSASDFSLWSDVWAQGVDPQEHQKKKRDLELQQQRKSPFFRKPGDWNCPWCKAMNISRRE
NCFRCRRGIWLQSP
Download sequence
Identical sequences 10141.ENSCPOP00000013737 ENSCPOP00000013737 ENSCPOP00000013737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]