SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000013796 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000013796
Domain Number 1 Region: 149-468
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.6e-124
Family Transglutaminase core 0.00000000327
Further Details:      
 
Domain Number 2 Region: 8-148
Classification Level Classification E-value
Superfamily E set domains 8.4e-41
Family Transglutaminase N-terminal domain 0.00013
Further Details:      
 
Domain Number 3 Region: 501-612
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 5.1e-28
Family Transglutaminase, two C-terminal domains 0.00024
Further Details:      
 
Domain Number 4 Region: 615-710
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.78e-24
Family Transglutaminase, two C-terminal domains 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000013796   Gene: ENSCPOG00000015309   Transcript: ENSCPOT00000015458
Sequence length 713
Comment pep:known_by_projection scaffold:cavPor3:scaffold_8:22099538:22118377:-1 gene:ENSCPOG00000015309 transcript:ENSCPOT00000015458 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSLSSPCPGVRVTKVDWQQKRNGAAHRTQEYACSELVVRRGQLFHISLHLTGVLDREETL
TLTVETGPQASEALHTKAVFQTAELEVGDAWTATKEAQKGDTVTVSLTSPPDAVIGRYLL
SARASSRRKHSDRKLGEFVLLFNPWCPEDDVFLASEEERQEYVLNDSGIIFRGVEKHIRA
QGWNYGQQFEEDILHICLSILDRSPSYQEDPATNVSYRHNPVYVTRVISAMVNSNNDRGV
VQGQWQGKYGGGTSPLHWRGSVAILQKWFKGKYKPVKYGQCWVFAGVMCTVLRCLGIPTR
VVSNFNSAHDTDRNLSVDKYVDSFGRTLEDLTEDSMWNFHVWNESWFARQDLGPAYDGWQ
VLDATPQEESEGVFQCGPASVTAIREGDIHLAHDGPFVFAEVNADYITWLWHEDESQERV
YSDTKKVGRCISTKAVGSNSRVDITDLYKYPEGSQKERQVYRKAMKKLLSVEARGQRSRI
QGPNRHGLQQDDFPEPPTKPSITGKFKVLEPPVLGHDLKLALSLANLTSQALKVQVNLSG
ATILYTRKPVAEILHESHTVKLDLQEEKKIPITISYSQYKKDLTEDKKILLAAMCLVTNG
DKLLVEKDITLEDFIIIKVLGPATVGVAVAVEVTVVNPLSETVKDCVLMVEGSGLLQGQL
SVDVPTLQPQERALVQFSITPSKSGPRQLQVDLVSPHFPDIKGFVIVHVATAK
Download sequence
Identical sequences ENSCPOP00000013796 10141.ENSCPOP00000013796 ENSCPOP00000013796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]