SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000013810 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000013810
Domain Number 1 Region: 169-289
Classification Level Classification E-value
Superfamily Troponin coil-coiled subunits 9.42e-33
Family Troponin T 0.0000374
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000013810   Gene: ENSCPOG00000015324   Transcript: ENSCPOT00000015473
Sequence length 294
Comment pep:known_by_projection scaffold:cavPor3:scaffold_12:21062483:21074010:1 gene:ENSCPOG00000015324 transcript:ENSCPOT00000015473 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDTEEVVEEYEDEPQDEDWREDEDEQEAAEEEADGGAGAEDETEEAKAEEDGEEEEGRE
AEDGPVEESKPKPRLFMPNLVPPKIPDGERVDFDDIHRKRMEKDLNELQTLIEAHFENRK
KEEEELISLKDRIEKRRAERAEQQRIRNEREKERQNRLAEERARREEEENRRKAEDEARK
KKALSNMMHFGGYIQKQAQTERKSGKRQTEREKKKKILAERRKVLAIDHLNEDQLREKAK
ELWQSIYDLEAEKFDLQEKFKQQKYEINVLRNRINDNQKVSKTRGKAKVTGRWK
Download sequence
Identical sequences ENSCPOP00000013810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]