SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000013853 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000013853
Domain Number 1 Region: 5-427
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 6.54e-98
Family Integrin alpha N-terminal domain 0.000000000000421
Further Details:      
 
Domain Number 2 Region: 728-956
Classification Level Classification E-value
Superfamily Integrin domains 1.88e-67
Family Integrin domains 0.00000000294
Further Details:      
 
Domain Number 3 Region: 428-587
Classification Level Classification E-value
Superfamily Integrin domains 2.14e-46
Family Integrin domains 0.0000000532
Further Details:      
 
Domain Number 4 Region: 588-721
Classification Level Classification E-value
Superfamily Integrin domains 1.2e-36
Family Integrin domains 0.000000234
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000013853   Gene: ENSCPOG00000015367   Transcript: ENSCPOT00000015517
Sequence length 1007
Comment pep:known_by_projection scaffold:cavPor3:scaffold_3:5103329:5176339:-1 gene:ENSCPOG00000015367 transcript:ENSCPOT00000015517 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XEGSYFGFAVDFFAPSASSRMFVLVGAPKANTTQPGIVEGGQVLKCDWSSSRRCQPIEFD
STGNRDYAKDDPLEFKSHQWFGASVRSKQDKILACAPLYHWRTEQKQEREPVGTCFLQSG
TKTVEYAPCRSKNIDADGQGFCQGGFSIDFTKKKSRILKSGPGSFYWQGQLISDQVAEII
SKYDPTVYSIKYSNQLATRTAQAVFDDSYLGYSVAVGDFNGDGVDVDFVSGVPRAARTLG
MVYIYDGKNMSSLYNFTGEQMAAYFGFSVAATDINGDDLADVFIGAPLFMDRGSDGKLQE
VGQVSLSLQAASGGFQTSKLTGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGGEGMKG
LVYIFNGRASGLNPAPSQTLAGQWAAQSMPPSFGYALKGATDIDRNGYPDLIVGAFGVDR
AVLYRARPVITVNAGLEVSPSILNQDNKTCPLPGTGLKVSCFNVRFCLKADGKGVLPRKL
NFQVELLLDKLKHKGAIRRALFLHNRSPGHSKNMTISRGGQKQCEELVAYLRDESEFRDK
LTPITIFMEYRLDYRTAADATGLQPILNQFTPANVSRQAHILLDCGEDNICKPKLEVSVD
SDQRKIYIGDDNPLTLIVKAQNQGEGAYEAELIVAIPPQADFIGVVRNSEALARLSCAFK
TENQTRQVVCDLGNPMKAGTQLLAGLRFSVHQQSEMDTSVKFDLQIQSSNLFDRVSPVVS
YRVDLAVLAAVEIRGVSSPDHIFLPIPNWEHKEKPETEEDVGPVVQHIYELRNNGPSSFS
KAMLNLQWPYRYNNNTLLYILHYDIDGPMNCTSDMEINPLRIQVSSSQATEKNDTGAGQG
DGNHLIVKRDLALSEGDVHTLGCGVAQCLKIICQVGRLDRGKSAILYVKSLLWTETFMNK
ENQNHSYSLKSSASFSVIEFPYKNLPIEDISNSTVVTTNVTWGLQPTPMPVPVWVIILAV
LAGLLLLAVLVFVMYRMGFFKRVRPPQEEQEREQLQPQENGEGNSEA
Download sequence
Identical sequences ENSCPOP00000013853 10141.ENSCPOP00000013853 ENSCPOP00000013853

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]