SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000013888 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000013888
Domain Number 1 Region: 91-170
Classification Level Classification E-value
Superfamily Ribosomal protein S18 1.19e-23
Family Ribosomal protein S18 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000013888   Gene: ENSCPOG00000015405   Transcript: ENSCPOT00000015555
Sequence length 262
Comment pep:known_by_projection scaffold:cavPor3:scaffold_314:136598:142737:-1 gene:ENSCPOG00000015405 transcript:ENSCPOT00000015555 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASILHTLLKRYPTLSPFRGINGVQFSLQTFCTEASSGKDSLPPAPVSPYENEPWKYLD
SEEYQSRYGSRPVWADYRRNHKGRIPPQRTRQTCIRKNKVAGNPCPICRDHKLHVDFRNV
KLLEQFVCAHTGIIFHAPYTGVCMKQHKKLTQAIQKARDHGFLSYHIPEVEPRDLDFKTC
HGAVSATPPAPTLLSGDPWYPWYSWKQPPERELSRLRRLYQGHLREESGPPPASLPPTPR
LHSGSRAQPGTSTGSGGVSSAI
Download sequence
Identical sequences 10141.ENSCPOP00000013888 ENSCPOP00000013888 ENSCPOP00000013888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]