SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000013890 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCPOP00000013890
Domain Number - Region: 71-146
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.00012
Family N-acetyl transferase, NAT 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000013890   Gene: ENSCPOG00000015407   Transcript: ENSCPOT00000015557
Sequence length 425
Comment pep:known_by_projection scaffold:cavPor3:scaffold_314:126794:136388:-1 gene:ENSCPOG00000015407 transcript:ENSCPOT00000015557 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFPFDVDALLPERITVLDQHLRPPARRPGTTTPARVDLQQQIMTIVDELGKASAKAQHL
PAPITSASRMQSNRHVIYVLKDTSARPAGKGAIVGFLKVGYKKLFVLDDREAHNEVEPLC
ILDFYIHESLQRHGHGRELFQYMLQKERVEPHQLAIDRPSQKLLKFLNKHYNLETTVPQV
NNFVIFEGFFAHQHRPPAPSLRASRLSRTTAAEPTPTAPARKLPPKRAEGDIKPYSSSDR
EFLKVAVEPPWPLNRAPRRATPTAHPPPRSSSLGSSPERGPLRPFVPEQELLRSLRLCPP
HPTARLLLATDPGGSPAQRRRTRGTPPGLLAQSRCYSRHRGPSPSAPGANEHRPSSPTTG
SSRPRDVAVSEDQQESGQGKRETESGCARGEPTSAPPAQRCTARGDALDARFVRSLQERR
STRPW
Download sequence
Identical sequences H0VTA3
ENSCPOP00000013890 10141.ENSCPOP00000013890 XP_004999363.1.53824 ENSCPOP00000013890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]