SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000013979 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000013979
Domain Number 1 Region: 613-728
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.31e-33
Family Spermadhesin, CUB domain 0.00064
Further Details:      
 
Domain Number 2 Region: 1830-1950
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.06e-32
Family Spermadhesin, CUB domain 0.00076
Further Details:      
 
Domain Number 3 Region: 1313-1419
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.2e-32
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 
Domain Number 4 Region: 1657-1777
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-32
Family Spermadhesin, CUB domain 0.00075
Further Details:      
 
Domain Number 5 Region: 445-554
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.32e-32
Family Spermadhesin, CUB domain 0.00048
Further Details:      
 
Domain Number 6 Region: 1132-1253
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.01e-30
Family Spermadhesin, CUB domain 0.00076
Further Details:      
 
Domain Number 7 Region: 70-172
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.27e-29
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 8 Region: 2001-2120
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.53e-29
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 9 Region: 273-383
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-28
Family Spermadhesin, CUB domain 0.0014
Further Details:      
 
Domain Number 10 Region: 2188-2291
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-27
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 11 Region: 972-1075
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.19e-26
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 12 Region: 792-901
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.22e-25
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 13 Region: 1486-1595
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.55e-23
Family Spermadhesin, CUB domain 0.0028
Further Details:      
 
Domain Number 14 Region: 2541-2609
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.04e-20
Family Complement control module/SCR domain 0.00091
Further Details:      
 
Domain Number 15 Region: 2598-2667
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.32e-18
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 16 Region: 2781-2849
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.31e-18
Family Complement control module/SCR domain 0.00081
Further Details:      
 
Domain Number 17 Region: 2897-2968
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.89e-17
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 18 Region: 2838-2908
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.14e-16
Family Complement control module/SCR domain 0.00096
Further Details:      
 
Domain Number 19 Region: 2657-2724
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000153
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 20 Region: 3015-3072
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000208
Family Complement control module/SCR domain 0.00074
Further Details:      
 
Domain Number 21 Region: 210-282
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000723
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 22 Region: 3077-3145
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000729
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 23 Region: 389-450
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000139
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 24 Region: 2713-2774
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000208
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 25 Region: 1252-1316
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000216
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 26 Region: 2355-2422
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000256
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 27 Region: 1426-1489
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000256
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 28 Region: 1948-2017
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000337
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 29 Region: 2957-3020
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000337
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 30 Region: 1077-1149
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000375
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 31 Region: 559-627
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000653
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 32 Region: 2483-2545
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000764
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 33 Region: 734-794
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000125
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 34 Region: 1602-1665
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000208
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 35 Region: 1776-1841
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000351
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 36 Region: 6-66
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000567
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 37 Region: 2293-2361
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000112
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 38 Region: 2119-2183
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000337
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 39 Region: 907-967
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000756
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 40 Region: 3136-3193
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000514
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 41 Region: 2436-2493
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000236
Family Complement control module/SCR domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000013979   Gene: ENSCPOG00000015501   Transcript: ENSCPOT00000015653
Sequence length 3426
Comment pep:known_by_projection scaffold:cavPor3:scaffold_1:69742957:70450826:1 gene:ENSCPOG00000015501 transcript:ENSCPOT00000015653 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLPSHTCGNPGEILKGILHGTRFNIGDKVRYSCLPGYILEGHAILTCIVSPGNGASWDFP
APFCRAEGACGGTLRGTSSTISSPHFPSEYENNADCTWTVLAEPGDTIALVFTDFQLEDG
YDFLEISGTEAPSIWLTGINLPSPVISSKNWLRLHFTSDSNHRRKGFSAQFQVKKAIELK
SRGVKMLPSKDSNHKNSVLSQGGVSSASDMCPDPGIPENGRRVGSDFRVGANVQFSCEDN
YVIQGSKAITCQRVTETLAAWSDHRPICRARTCGSNLRGPSGVITSPNYPVQYEDNAHCV
WVITTADPDKVIKLAFEEFELERGYDTLTVGDAGKVGDTRSVLYVLTGSSVPDLIVSMSN
QMWLHLQSDDSIGSPGFKAVYQEIEKGGCGDPGVPAYGKRTGSSFLHGDTLTFECQAAFE
LVGERVITCQQNNQWSGNKPSCVFSCFFNFTASSGIILSPNYPEEYGNNMNCVWLIISEP
GSRIHLIFNDFDVEPQFDFLAVKDDGISDVTVLGTFSGNEVPAQLASSGHIVRLEFQSDH
STTGRGFNITYTTFGQNECHDPGIPINGRRFGDRFLLGSSVSFHCEDGFVKTQGSESITC
ILQDGNVVWSSTVPRCEAPCGGHLTASSGVILPPGWPGYYKDSLNCEWIIEAKPGHSIKI
TFDRFQTEVNYDTLEVRDGPASSSPLIGEYHGTQAPQFLISTGNYMYLLFSTDSSRASVG
FLIHYESVTLESDSCLDPGIPVNGHRHGSNFGIRSTVTFSCDPGYTLSDEEPLVCERNHQ
WNHALPSCDALCGGYIQGKSGTVLSPGFPDFYPNSLNCTWTIEVSHGKGVQMIFHTFHLE
SSHDFLLITEDGSFSQPVARLTGSVLPHTIKAGLFGNFTAQLRFISDFSISYEGFNITFS
EYDLEPCDDPGVPAFSRRIGFHFGVGDALTFSCFPGYRLEGAAKLTCLGGGRRVWSAPLP
RCVAECGASVKGNEGTLLSPNFPSNYDNNHECIYKIETEAGKGIHLRARSFQLFEGDTLK
VYDGKDSSSRPLGTFTRNELLGLLLNSTSNHLWLEFNTNGSGTDLGFQLTYTSFDLVKCE
DPGSPNYGYRIRDEGHFTDTVVLYSCNPGYAMHGSSTLTCLSGDRRVWDKPVPSCVAECG
GHIHTATSGRILSPGYPAPYDNNLHCTWTVEADPGRTISLHFIVFDTELAHDILKVWDGP
VDSDILLKEWSGSALPEDIHSTFNSLTLQFDSDFFISKSGFSIQFSTSVASTCNDPGMPQ
NGTRYGDSREPGDTLTFQCDPGYQLQGQAKVTCVQLNNRFFWQPDPPTCIAACGGNLTGP
SGVILSPNYPQPYPPGKECDWRVKVNPDFVIALIFRSFNMEPSYDFLHIYEGEDSNSPLV
GSFQGSQAPDRIESSGNSLFLAFRSDASVGLSGFAIEFKEKPREACFDPGNIMNGTRVGT
DFKLGSTVTYQCDSGYRIVEPSSITCVIGTDGKPSWDHVLPSCRAPCGGQYSGSEGVVLS
PNYPHNYTAGQVCLYTITVPKEFVVFGQFASFQTALSDMAELFDGAQPQARLLSSLSGSH
SGETLPLATSNQILLRFSANSGASARGFHFLYQAVPRTSDTQCSSVPEPRYGRRIGSEFS
AGSIVRFECSPGYLLQGSSAIRCQSVPNALAQWNDTIPSCVVPCSGNFTQRRGTILSPGY
PEPYGNNLNCVWRILVTEGSGIQIQVISFATEQNWDSLEIHDGGDVSAPRLGSFSGTTVP
ALLNSTSNQLYLHFQSDISVAAAGFHLEYKTVGLAACQEPALPSNGIKLGDRYMVNDVLS
FQCEPGYTLQGRSHISCMPGTVRRWNYPSPLCIATCGGMLTDPGGVILSPGFPGSYPNNL
DCTWKISLPIGYGTHIQFLNFSTEANHDYLEVQNGPYPTSPMIGQFSGPDLPLSLLSTTH
ETLIRFYSDHSQNRQGFKLTYQAYELQNCPDPPPFQNGYMVNSDYSVGQSISFECYPGYI
LIGHPVLTCQHGTNRNWNHPFPRCDAPCGYNVTSQNGTIYSPGFPDEYPILKDCLWLITV
PPGHGVYINFTLLQTEAVNDYIAVWDGPDQNAPQLGVFSGNTALETAYSSTNQVLLRFHS
DFSNGGFFVLNFHAFQLKKCPPPPAVPHADMLTEDEDFEIGDFVKYQCHPGYTLSGRDTL
TCKLSAQLQFEGVAPTCEAQCPANEIRTESSGVILSPGYPGNYFNSQTCSWSIKVDPSFN
ITIFVDSFQSEKQFDSLEVFDGSSGQSPLLVILSGNHSEQSNFTSRGHQLFLRWSTDHAT
SKRGFRIRYTAPYCSLSSTLKNGGVVNRTVGAVGSTVRYFCKPGYRMVGPSNATCVRSPM
GMYQWDSLTPICQAVSCGIPEAPGNGSFTGNEFTLDNKVMYECNEGFRLEASQQASAVCR
EDGTWSNRGKTPACKPVLCPSIEAQLSEHILWRLVSGSLNEYGAQVLLSCSPGYYLEGRR
LLQCQANGTWNTGDERPRCRVISCGSLSFPPNGNKIGTLTVFGATAIFTCNTGYTLVGSH
VRECLANGLWSGSETRCLAGHCGSPDPIVNGHISGDGFSYRDTVVYQCNPGFRLVGTSVR
ICLQDHKWSGQTPVCVPITCGHPGNPAHGVTNGSEFNLNDLVNFTCDTGYLLQGSSRAQC
RSNGQWSSPLPTCRVVNCSDPGFVDNAVRHGPQSFPESFEYGTSVLYHCKKGFYLLGSSA
LTCMASGLWDRSLPTCLAISCGHPGVPANAVLTGELFTYGARVQYSCKGGQSLTGNSTRI
CQEDSHWSGALPHCSGSSPGFCGDPGTPAHGSRLGDEFKTKSLLRFSCEMGYQLRGSAER
MCLPNGSWSGVQPACEAVSCGNPGTPTNGRIVSSDGVLFSSSVVYACWEGYKTSGLTTRH
CTANGTWTGTAPDCTIISCGDPGTLPNGVQFGTDFTFNKTVSYQCNPGYLMEPVSACVIR
CTKDGTWNQSKPVCKAVLCGQPPAVPDGKVEGTDFHWGASISYSCADGFQLSHSAILSCE
GHGVWKGEVPQCLPVFCGDPGIPAEGRVSGKSFTFRSEVFFQCKAPFILVGSSRRTCQAD
GTWSGIQPTCIDPAHNTCPDPGTPHFGIQNSSRGYEVGSTVFFRCRKGYHVQGSTTRTCL
ANLTWSGMQTECTPHACRQPETPAHADVRAIDLPTFGYTLVYTCHPGFFLAGGSEHRTCK
ADMKWTGKSPVCKSKGVREVNETVTKTPVPSDVFFANSVWKGYYEYLGKRQPATLTVDWF
NATSSKVNATFTTAPQVQLDLTGVYKKEEAHLLLKAFQMKGPVDIFVSKFENDNWGLDGY
VSSGLEKEGFTFQGDIHGKDFGKFKLERQDPSSSDQDPSNQYHGTSSGSVAAAILVPFFA
LILSGFAFYLYKHRTRPKVQYNGYAGHENSNGQASFENPMYDTNLKPTEAKAVRFDTTLN
TVCTVV
Download sequence
Identical sequences 10141.ENSCPOP00000013979 ENSCPOP00000013979 ENSCPOP00000013979

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]