SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000014000 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000014000
Domain Number 1 Region: 355-665
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 9.42e-56
Family Integrin alpha N-terminal domain 0.0000333
Further Details:      
 
Domain Number 2 Region: 187-379
Classification Level Classification E-value
Superfamily vWA-like 1.53e-44
Family Integrin A (or I) domain 0.0000386
Further Details:      
 
Domain Number 3 Region: 814-943
Classification Level Classification E-value
Superfamily Integrin domains 2.2e-26
Family Integrin domains 0.0047
Further Details:      
 
Domain Number 4 Region: 665-810
Classification Level Classification E-value
Superfamily Integrin domains 0.0000518
Family Integrin domains 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000014000   Gene: ENSCPOG00000015524   Transcript: ENSCPOT00000015676
Sequence length 1164
Comment pep:known_by_projection scaffold:cavPor3:scaffold_32:18346137:18388992:1 gene:ENSCPOG00000015524 transcript:ENSCPOT00000015676 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGELNFLICETGLAPLGAFNVDVTRPWVTREGGAPFVLSSLLHQDPSTNQTWLLVTSSRS
NRASAPLHRCSLAQDEIVCQPVEHVLVPKGKYRGVTVVRSHHGILICVQAQGRRPHSLSS
ELTGTCSLLAPDLRPRAYANFSDIENLLDPDTYVDVHDCNRNTEGRTEAKNRARKSRALE
EVEEEEEAEEAGTEIAIVLDGSGSIDPPDFQKAKEFISNMMKMFYEKCFECNFALVQYGA
VIQTEFDLRDSQDVNASLARVQNIIQVGNVTKTASAMQHVLDNIFTPSRGSREKASKVMV
VLTDGDIFEDPLNLTSVISSPKMQGVERFAVGVGNAFEKVKTDRELKQIASTPSETHAFK
VTNYTALNGLLSKLQQSIIHTEGTVGEALRYQLAQTGFSAQILDEGQVLLGAVGAFNWSG
GALLYDTRCRWGRFLNHSAADAGAAQYSYLGYSVAVLHNAHGVSYIAGAPRYRQRGAVFK
LRPESKEATFVQEGEQLGSYFGSELCPVDVDMNGITDVLLVAAPFYHDHGEKGRVYVYSL
HKQDGSFSLAHILSGCPGFPSARFGFAMAAVGDINQDKFTDVAIGAPLEGLEMNDGDSFG
SVYIYNGHQDGLSSKPSQWIRASAVAPGLRYFGVSVAGGLDFSGDGLADITVGTMGRATV
LRSRPVVHLKVSMTFTPSALPIGFTGSVNGHLCFEVSPTTAAAESGLREKSLNFTVDVDV
AKSRKRLQCVDVGECLNHHQQWSIGPRLCKSLQLVSTEGELCEEDCFSNITVKVIYQLQD
PEGWRRDSCPILANKEPFAVFQLPYQKACKNNLFCNAELQLATSMSQQELVVGLTKELTM
NISLTNSGEDSYLTSMALNYPRNLHFKMLQKPPSPNVQCTNPKPAASVLVMTCKIGYPIL
RRSSVNMSIVWQLEESPFPNRTAHITVTISNSDERSLATETHSLQFRHAFTAVLSKPSVM
YMNTSQRLSDYKEFLFSIHGENRFKAQFQLQICVPTKLQGLQVVRVKNLTKIQDSTECIQ
SQESACGSTPVQHVEEWHSVSCNITSDEENVTVAAEISLGHSNQLQRDITDLQVLGEISF
NKTLYEGLKAENHRTKITVIFLKDEVYHSLPVIIGSSVGGLLVLIVIIIILFKCGFFKRK
YQQLNLESVRRAQLRAEDLLTEGN
Download sequence
Identical sequences H0VTJ8
10141.ENSCPOP00000014000 ENSCPOP00000014000 ENSCPOP00000014000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]