SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000014013 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000014013
Domain Number 1 Region: 219-381
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 9.12e-43
Family Pentapeptide repeats 0.00024
Further Details:      
 
Domain Number 2 Region: 89-192
Classification Level Classification E-value
Superfamily POZ domain 2.94e-25
Family Tetramerization domain of potassium channels 0.01
Further Details:      
 
Domain Number 3 Region: 2-75
Classification Level Classification E-value
Superfamily Doublecortin (DC) 0.00000484
Family Doublecortin (DC) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000014013   Gene: ENSCPOG00000015540   Transcript: ENSCPOT00000015692
Sequence length 392
Comment pep:known_by_projection scaffold:cavPor3:scaffold_1:61693223:61716171:-1 gene:ENSCPOG00000015540 transcript:ENSCPOT00000015692 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRVTLFLNGSPKNGKVVAVYGTLSDLLSVASSKLGIKATSVYNGKGGLIDDIALIRDDD
VLFVCEGEPFIDPQTDSKPPEGLLGCDTDWLTLNVGGRYFTTTRILRSTLVNKEPDSMLA
HMFKDRGVWGNKQDHRGAFLIDRSPEYFEPILNYLRHGQLIVNDGINLLGVLEEARFFGI
DSLIEHLEVAIKNSQPPEDHSPISRKEFVRFLLATPTKSELRCQGLNFSGADLSRLDLRY
INFKMANLSRCNLAHANLCCANLERADLSGSVLDCANLQGVKMLCSNAEGASLKLCNFED
PSGLKANLEGANLKGVDMEGSQMTGINLRVATLKNAKLKNCNLRGATLAGTDLENCDLSG
CDLQEANLRGSNVKGAIFEEMLTPLHMSQSVR
Download sequence
Identical sequences 10141.ENSCPOP00000014013 ENSCPOP00000014013 ENSCPOP00000014013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]