SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000014095 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000014095
Domain Number 1 Region: 1050-1319
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.89e-42
Family Extended AAA-ATPase domain 0.011
Further Details:      
 
Domain Number 2 Region: 1741-2000
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.97e-39
Family Extended AAA-ATPase domain 0.07
Further Details:      
 
Domain Number 3 Region: 660-722,818-980
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.04e-32
Family Nitrogenase iron protein-like 0.071
Further Details:      
 
Domain Number 4 Region: 1365-1619
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.34e-32
Family Shikimate kinase (AroK) 0.073
Further Details:      
 
Domain Number 5 Region: 300-506,540-592
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.39e-30
Family Extended AAA-ATPase domain 0.018
Further Details:      
 
Domain Number 6 Region: 2058-2114,2225-2327
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.01e-20
Family Extended AAA-ATPase domain 0.043
Further Details:      
 
Domain Number 7 Region: 5392-5596
Classification Level Classification E-value
Superfamily vWA-like 0.0000000000000084
Family Integrin A (or I) domain 0.051
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000014095
Domain Number - Region: 3052-3108
Classification Level Classification E-value
Superfamily S-adenosylmethionine decarboxylase 0.00706
Family Bacterial S-adenosylmethionine decarboxylase 0.0067
Further Details:      
 
Domain Number - Region: 658-808
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0194
Family ABC transporter ATPase domain-like 0.053
Further Details:      
 
Domain Number - Region: 39-207
Classification Level Classification E-value
Superfamily ARM repeat 0.064
Family Leucine-rich repeat variant 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000014095   Gene: ENSCPOG00000015626   Transcript: ENSCPOT00000015781
Sequence length 5606
Comment pep:known_by_projection scaffold:cavPor3:scaffold_49:3306788:3465813:-1 gene:ENSCPOG00000015626 transcript:ENSCPOT00000015781 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHLSMEVAAARLRLIASKNEKSRGELGRFLAKQVWTPQDRQCILNILAQLLLDKDYTML
LGRQLRPLLLDLLERNAETIKTGGQINHDLHERLCVSMSKLIGHPDVLLFALRYFRDTSP
VFQRLFLESSDANPVRYGRRRMKLRDLMEAAYKFLQQEQSVFRELWDWSVCVPLLRSHDT
LVRWYTANCLALVTCMNEEHKLSFLKKIFSSEELIHFRLRLLEEAQLQDLEKALVLANPE
ASLWHKEKELQYLQGHLISTDLSSQVTAVCGVVLPRQLPAPGQQNASDSSSREQELALRS
YVLTESVCKNLQTLAMAVASQNAVLLEGPIGCGKTSLVEHLAAMTGRRKPPLLLKVQLGD
QTDSKMLLGMYRCTDVPGEFVWQPGTLTQAATKGHWILLEDIDYAPLDVVSVLIPLLENG
ELLIPGHSDSLKVAPGFQFFATRRLLSCGGNWYRPLNSHATLLDKCWTKIHLDNLDKKEL
REVLQSRYPSLLPAADHLLDIYIQLTGEKHHCQSESSVEWEQGPQEVLEARKESKRLVLE
GRELSLRDLLNWCNRIAHSFDSSSSSASLNIFQEALDCFTAMLSEHTSKLKIAEIIGSKL
NISRQKAEFFCQLYKPEIVINELDVQVGRVRLLRKQSEAVHIQNSREKLTFAATRPSSVL
IEQLAVCVSKGEPVLLVGETGTGKTSTVQYLAHITEGHRLRVINMNQQSDTADLLGGYKP
VDHKLIWLPLRETFEELFVQTFSKKQNFTFLGHIQTCYRQKRWHDLLRLMQHVYKSAINK
EAKESETGVLLKEKWEAFGLRLNHAQQQMKMTENSLLFAFVEGTLAQAIKKGEWILLDEI
NLAAPETLECLSGLLEGSSGSLVLLDRGDTEPLVRHPDFHLFACMNPATDVGKRNLPPGI
RNRFTELYVEELGSKEDLQILIVDYLKGMSINKTTVQGIISFYTALRKESGTKLVDGTGH
RPHYSLRTLCRALRFAASNPCNNIQRSLYEGFCLGFLTQLNRTSHPIVQKLICQHIISGN
VKSLLKQPIPEPKGGRLIQVEGYWISVGDKEPTIDETYVLTSSVKLNLRDIVRVVSAGTY
PVLIQGETSVGKTSLIRWLAAATGNYCVRINNHEHTDIQEYIGCYTSDASGKLVFKEGVL
IDAMRKGYWIILDELNLAPTDVLEALNRLLDDNRELLITETQEVVKAHPRFMLFATQNPP
GLYGGRKVLSRAFRNRFVELHFDELPSPELETILHKRCSLPPSYCTKLVKVMLDLQSYRR
SSSVFAGKQGFITLRDLFRWAERYRLTEQTEKEYDWLQHLANDGFMLLAGRVRKQEEIDV
IQEVLEKHFKKKLCPQYLFSKENVLQLLGKLSTQMSALESGNFSHVVWTEGMRRLAILVG
RALEFGEPVLLVGDTGCGKTTICQIFAALANQKLYSVNCHLNMETSDFLGGLRPVRQKPS
DKEEMNTSRLFEWHDGPLVLAMKEDSFFLLDEISLADDSVLERLNSVLEVEKSLVLAEKG
SPEDKDNEVELLTAGKNFRILATMNPGGDFGKKELSPALRNRFTEIWCPQSTKREDLIQI
INHNLCPGLSLGKTDCKGADIAEVMLDFIDWLIQQEFGRKCVVSIRDILAWVNFMNIMSK
ETAGKKPEAISTVTSFVHAACLVYIDGIGSGVTSSGFGTALLAREECLKFLIKKISKIVR
LTEYQKNELKIYDRLKAKEFTGIDNLWGIHPFFIPREGPVLHRSNIADYALSAGTTAMNA
QRLLRAIKLNKPILLEGSPGVGKTSLVGALAKASGNTLVRINLSEQTDITDLFGADLPVE
GGKGGQFAWRDGPLLAALKAGHWIVLDELNLASQSVLEGLNACFDHRGEVYVPELGMSFQ
VQHEKTKIFGCQNPFRQGGGRKGLPRSFLNRFTQQVFVDPLTVIDMEFIASTLFPAIDKN
IVKKMVAFNNQIDHEVTVEKKWGQKGGPWEFNLRDLFRWCQLMLVDQSPGCYDPGQHVFL
VYGKRMRTRGDEEKVIAVFKDVFGSNSSPYIGTRLFHITPYEVQLGYSVLSRGSYVPHPC
RRPLLLLHQSFQSLESIMKCVQMSWMVILVGPASVGKTSLVQLLAHLTGHTLKIMSMNSA
MDTTELLGGSEQVDLRPWRQLLERVEDTVRGLLRASLLVSTDDAEVVLRAWSHFLTYKPK
CLREDAKGITVETVNKLEAVLLLMQRLNNKINSYSKAEFAKLLEDFRSFGVKLIQSSSGC
NHGTFEWVDSMLVQALKSGDWLLLDNVNFCNPSVLDRLNALLEPGGVLTINERGMMEGSI
PTITPHPNFRLFLSMDPVHGEISRAMRNRGLEIYISGEGDETIPDNLDLKVLLHSLGLVG
DSVCDILLALHSETRSSIIGSPTSSVSALIQTAVLIVQDLQRGLGLDKAFFEACWKVYVR
SQHSAANQKLVQALLEKHVSFLQARENWGNSILAAGLWPDSVPSALFATEDSHLSVVRSD
GQILVYCLNRISMKTSSWTRSQPLTLQDLEKIMQSPNPENLKFSAVQMDAYWIDEPEVLA
MAVKLLIERSTNQDWMLRVKWLYHLARNIPQGLESIQIHLEASAASLRNFYSNSLSAGVP
NIFKILQANITVDDFVIPLDPRWNMQALDIIRNSMNFDPQTDQPEQLFPLLESIANKAII
YLDREKRIFTEAHLVSIGGKTLNSVLRMSFEFHKEDPESYHSLPHEVVVNLAAFFELCDA
LILLWVQSAQGMVSNTNVHAILGSVRWRDRFWTVADAVKVDAPGLSLLALHWHWVLKHLV
LQIPQHLMNYEDKYYKEVQTVSEHIQNCLGSPTGGFSGIKKLQKFLGRPFPFKDKRVVEC
FSQLKVLNKALAIRERMLVLGEGECQEDIHRLQVIASEWTFKKSLLQAWGLILRANILED
VNLDELKNLVSIQCSELKAKGLLLGFLERTLGETSSLPQPGFTSLIQLARHVQLWPAMEY
LAILWRYKVMADFMTQICLRRSNKNQQPQIDEAISHHVTFCLKHTPVTPQELRDLWSLLH
YKKVSTEEIICLWSELFNSTFASFWSSTVTTNTEYWLTWNPLLHMPQKGNPKSLLDSTLK
GPGSFCKAIFSKCCFEVLTSSCRAGPWDVSGLPVLSSSHVTLGEWVERVQQLRDINSLLW
TNMAVSSVAAFRRTDSRLQGLVLCRHLMGLAELFPESRRHEYMQNCEQLLLGDRQSFQHI
CQVLGDLAGQQALSKELLCLLLTSLRYFFGEGETKRNLPESARRGSLWVSLGLLQIQTWL
PQACFDPAVKREYKLKYAKEELHQLQCEQKTRNLSCQLQTGRDLDDEVIVSSSHPHVRFL
QQRIDQLENSVHRLLKKQAFRPQLPAYESLVQEIHHYVSSIAKVDSIQDLLTRLLQALLT
DGMRSAQVAQSLLKEEASWQQSQHQFRKRLGEEYALYPDIVTPLQASILQLQHGMRLVAS
EVQTSLYGSVICTDRLESLATALLAFPSVGPIFPTYYAHADALCSVKSEEVLRGLGKLVI
KRLGGKEPEGKGQQPCPTREQLLMNALLYLHSHVLCKGEMDQRALLLFRHVCQEMINEWD
EQERVAQEKVERENSLYRYKSTSSRTELSEEEEEEREFRKQFPLHEKDFADILVEPVLEE
KRTTSDGQEEEATTDPALLSQSSMQAVMLIHQHLCLNFARSLWYQQQTVPSYETKHYLSL
FLSCYQTGASLVTHFYPLMGVEVNDQLLGSQLLACTLSHNTLSGEAASDLMVNPAGPYDF
YQHPNVPEAQQCQSVLQGFSEAVSQLLQDWPEHPALEQLLVVMDRIRSFPLSSPISKFLN
GLEILLAKAQDWEENASRALSLRKHLNLVSQIIIHWRKLELNCWSMSLDNTMKRHTEKST
KHWFSIYQMLEKHMQEQTEDHEDDKQMTLMLLVSTLQAFIEGSSLGEFHVRLQMLLVFHC
HVLLMPQVEGKDSLCSVLWNLYHYYKQFFDRVQAKIVELRSPLEKELKEFVKISKWNDVS
FWSIKQSVEKTHRTLFKFMKKFEAVLSEPCRSSLVESSEEEQPDFLPRPTDEATSKETSP
IQCLNRALRETLLTWPPAGQATIPEQCPSTAPFSMEGELLCRLPRLVKRMRKICLSFMKE
SPWPHLVESLDQFTGEVISSVSELQHLKVEPSAEKEKQRSEAKHILMQKQRALSDLFKHL
AKTGLSYRKGLTWVRSKNPQELLHLHPLDLRRALSIVSSTQEADSRLLAEIASSWDGCQK
YFYRSLARHTRLNAALAAPAKEMGMGNIERCKGFSAHLMKILIRQRRSLTALTEQWIILR
NLLSCLKEIHGRLTAPLVYPVAFPPQDGMQQWTERLQHVAMQSQILLEQLSWLFQCCPRA
GLYAGHGQAPVQGPPSSPHLERRELPKEQLSGAVPGVVTSDVDYPSPVPGIQLPSSCRMR
KQDQLWQESTARITELLKIIKTMKADVDKIRQQSCETLYHSWKDFEVCSSGLTCLSQVSA
HLQDLRSLFIIPGMEVEQTDAPMALVESLEYVKREIDKAVNDFTSWKTHLLTSSSPGRTQ
MLDEKFVEDFSEQMETAIRAMLCAIQNLAERNSKKAETSTSQGTPQNEEGMTVGALRDFE
RLQPGHLTKLLEDDFWADVSTLHVQKIISAISELLERLKSYGEDGTASKHMLVSQSCCLL
VRLVPMLCSVSDLVLFFLTMSLATHRSTAKLLSVLAQVFTELAQKGYCLPKEFVEDSSGE
GATEFHDYEGGGLGEGEGTKDVSEKIESEEQVEDSFQKGREKNNEEPDSKSDIKGEDNAI
EMSEDFEGKMHDGELEEQEDDDDKSDSEGEELDKQMGDLNGEEADKLDERLWGDDDEEED
EEDHRTEETGPGMDEEDSELVAKDDNWDAGNFDKDKSQQNKKQEKEAAESDDDGQGQDKI
NEQIDEREYDENEVDPYHGNQEQLQEPEALNLPDNLNLDSEDQNVGEDTDNEEGEEENPL
EIKEKSVDTEEAGHETEEMTAETEAEAEQNEGEGPHEPEEKPHGEDKEEGEEEMDTAADD
QDKVTAEQPEGNLEEQQQSLEEKDREDTADGGEKSIPVEEGLQTQQKEDGEKSDTEEQVP
EAAERKEHASCGQTDVENVQSAQAVELAGAAPEKEQGKEEHGSGAADANQAEGHESNFIA
RLASQKHTRKNTQSFKRKPGQADNERSMGDHNEHVHKRLRTVDNDTQPEQGPSQPHVQVE
DADVFEHIKQGSDTYDTQTYDVASKEQQQTAKEWSRIEDVVMDTEEQEELRTADTEQLKP
EEVKSGATAASGFDEMETHTGKTEEQEKPKTDGSQKETVDKKPERSQDSTIHTAHQFLMD
TIFQPFLKDVSEVRQEMERQLETWQLQESGNAEEEKAAAEMWQSYLILTAPLSQQLCEQL
RLILEPSQAAKLKGDYRTGKRLNMRKVIPYIASQFRKDKIWLRRTKPSKRQYQICLAIDD
SSSMVDNPYQTALAFESLAVIGNALTLLEVGQIAICSFGESVKLLHPFHEQFSDYAGAQI
LRLCKFQQKKTRIAQFLESAASMFAAAQHFSQNMSPETAQLLLIVSDGRGLFLEGKERVL
AAVQAARNANIFVIFVVLDSPSSRDSILDIKVPIFKGPGEMPEIRSYMEEFPFPFYIILR
DVNALPETLSDALRQWFELVTASDHP
Download sequence
Identical sequences ENSCPOP00000014095 10141.ENSCPOP00000014095 ENSCPOP00000014095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]