SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000014133 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000014133
Domain Number 1 Region: 572-637
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000264
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 2 Region: 501-547
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000902
Family TSP-1 type 1 repeat 0.00059
Further Details:      
 
Domain Number 3 Region: 628-684
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000236
Family Complement control module/SCR domain 0.0029
Further Details:      
 
Domain Number 4 Region: 26-73
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000288
Family TSP-1 type 1 repeat 0.0028
Further Details:      
 
Domain Number 5 Region: 79-119
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000255
Family LDL receptor-like module 0.0014
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000014133
Domain Number - Region: 453-491
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0112
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000014133   Gene: ENSCPOG00000015671   Transcript: ENSCPOT00000015826
Sequence length 845
Comment pep:known_by_projection scaffold:cavPor3:scaffold_29:15757171:15812491:-1 gene:ENSCPOG00000015671 transcript:ENSCPOT00000015826 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQVISLFILVGFAGELQVFSSVSSPIDCQWNPYGQWTECNGCTKTQTRRRTVAVYGQFGG
QNCTGNAFETRSCEPTQGCPTEGGCGERFRCFSGQCISKSLVCNGDSDCEPDGADEDRCE
DSESRPSCDIHQPPPNIELTGTGYNALTGEFKKGVINTKSFGGQCRKVFSADGKQFYRLS
GNILSYTFQIQDNNTFNCFKFYISTWSYIKQTLTEYESSRSSKFFFRSSLSRSYNHASSL
KEEFKEKNYQLLVIQNTVEVAQFINNNPEVLQLAEPFWKELSYLPSLYDYSAYRRLIEQY
GTHYLQSGSLGGEYKVVFYVDSAKVKARDSSSEKGKKCSSSDFNFIFVSHSESKCENLGA
DSQLDSGTKNNMLEGESFVRGGTSALISGLKFLDLKNPADNKKRYSLWAESVPSLPQVIK
QKLTPLYELVKEAPCAAVKRLYLKRALEEYLDEFDPCHCRPCQNGGVAIVVGTQCQCNCK
PYTKGVACEQGVLVGDHAGGIDGGWSCWSSWSPCVQGKKTRTRACNNPYPSAGGKSCIGE
TTETRQCEDEELEHLRLLEPHCFPLSLVPKEFCSSPPALKDGFVQGEDTKFPVGKNIVYT
CKEGYSLVGDPVARCGEDLQWIVGEMHCQKIACALQVLMNGIQIHPHKPFYAVGEKVTLS
CSGGMSLEGPSVFLCGSSLKWSPEMKNVRCVQKDVPLTQAAPECQLWEKVQSSRCVCKMP
YECGSSLDVCAQDERSKRIVPLTVCKMHVLHCRGRNYTLAGRDSCSLPVLAQKTCGACSL
WEKCDAQSNRCVCRQASECQEQGINICMEVNGEEQTMSECEAGVLRCRGQSISVTSVEAC
AADPQ
Download sequence
Identical sequences 10141.ENSCPOP00000014133 ENSCPOP00000014133 ENSCPOP00000014133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]