SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000014168 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000014168
Domain Number 1 Region: 1351-1578
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.04e-39
Family Laminin G-like module 0.0034
Further Details:      
 
Domain Number 2 Region: 396-508
Classification Level Classification E-value
Superfamily Cadherin-like 1.28e-30
Family Cadherin 0.00088
Further Details:      
 
Domain Number 3 Region: 811-917
Classification Level Classification E-value
Superfamily Cadherin-like 1.34e-28
Family Cadherin 0.00055
Further Details:      
 
Domain Number 4 Region: 501-606
Classification Level Classification E-value
Superfamily Cadherin-like 3.93e-28
Family Cadherin 0.001
Further Details:      
 
Domain Number 5 Region: 1601-1794
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.63e-28
Family Laminin G-like module 0.027
Further Details:      
 
Domain Number 6 Region: 181-284
Classification Level Classification E-value
Superfamily Cadherin-like 5.28e-26
Family Cadherin 0.0016
Further Details:      
 
Domain Number 7 Region: 912-1027
Classification Level Classification E-value
Superfamily Cadherin-like 6.85e-26
Family Cadherin 0.0013
Further Details:      
 
Domain Number 8 Region: 703-810
Classification Level Classification E-value
Superfamily Cadherin-like 7.59e-26
Family Cadherin 0.0018
Further Details:      
 
Domain Number 9 Region: 286-394
Classification Level Classification E-value
Superfamily Cadherin-like 4.43e-25
Family Cadherin 0.0014
Further Details:      
 
Domain Number 10 Region: 606-707
Classification Level Classification E-value
Superfamily Cadherin-like 1.44e-21
Family Cadherin 0.0015
Further Details:      
 
Domain Number 11 Region: 1020-1122
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000271
Family Cadherin 0.0082
Further Details:      
 
Domain Number 12 Region: 1278-1368,1565-1614
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000738
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 13 Region: 1927-1967
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000393
Family Laminin-type module 0.0094
Further Details:      
 
Domain Number 14 Region: 1833-1879
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000344
Family EGF-type module 0.015
Further Details:      
 
Domain Number 15 Region: 1798-1832
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000508
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000014168
Domain Number - Region: 2428-2641
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0641
Family Rhodopsin-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000014168   Gene: ENSCPOG00000015714   Transcript: ENSCPOT00000015869
Sequence length 2925
Comment pep:known_by_projection scaffold:cavPor3:scaffold_2:33408404:33429959:1 gene:ENSCPOG00000015714 transcript:ENSCPOT00000015869 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSRAASGPLPTPLLPPPPPPLLLLLLLLPPLLGNQVGPCRSLGSGGRGSSGGCAPVGWL
CPASASNLWLYTSRCKDAGTELTGHLVPHHDGLRVWCPESGAHIPLPPAPEGCPWSCRLL
GIGGHLSPQGKLTLSQEHLCLKAPRLRCQSCKLAQTPGLRVGEGLPEESMGGRRKRNVNT
APQFQPPSYQATVPENQPAGTSVASLRAIDPDEGEAGRLEYTMDALFDSRSNHFFFLDPV
TGVVTTAEELDRETKSTHVFRVTAQDHGMPRRSALATLTILVTDTNDHDPVFEQQEYKES
LRENLEVGYEVLTVRATDGDAPPNANILYRLLEGSGGGPSEVFEIDPRSGVIRTRGPVDR
EEVESYKLIVEASDQGRDPGPRGATAAVFLSVEDDNDNAPQFSEKRYIVQVREDVAPGAP
ILRITASDRDKGSNALVHYSIMSGNARGQFYLDAQTGALDVVSPLDYETTKEYTLRVRAQ
DGGRPPLSNVSGLVTVQVLDINDNAPIFVSTPFQATVLESVPLGYLVLHVQAIDADAGDN
ARLEYRLAGVGHDFPFTINNGTGWISVAAELDREEVDFYSFGVEARDHGTPPLTASASVS
VTILDVNDNNPTFTQPEYTVRLNEDAAVGTSVVTVSAVDRDAHSVITYQITSGNTRNRFS
ITSQSGGGLVSLALPLDYKLERQYVLAVTASDGTRQDTAQIVVNVTDANTHRPVFQSSHY
TVNVNEDRPAGTTVVLISATDEDTGENARITYFMEDSIPQFRIDADTGAVTTQAELDYED
QVSYTLAITARDNGIPQKSDTTYLEILVNDVNDNAPQFLRDSYQGSVYEDVPPFTSVLQI
SATDRDSGLNGRVFYTFQGGDDGDGDFIVESTSGIVRTLRRLDRENVAQYSLRAYAVDKG
MPPARTSMEVTVTVLDVNDNPPVFEQDEFDVFVEENSPIGLAVARVTATDPDEGTNAQIM
YQIVEGNIPEVFQLDIFSGELTALVDLDYEDRPEYILVIQATSAPLVSRATVHVRLLDRN
DNPPVLGNFEILFNNYVTNRSSSFPGGAIGRVPAHDPDISDSLTYSFERGNELSLVLLNG
STGELRLSRALDNNRPLEAIMSVLVSDGVHSVTAQCALRVTIITDEMLTHSITLRLEDMS
PERFLSPLLGLFIQAVAATLATPPDHVVVFNVQRDTDAPGGHILNVSLSVGQPPGPGGGP
PFLPSEDLQERLYLNRSLLTAISAQRVLPFDDNICLREPCENYMRCVSVLRFDSSAPFIA
SSSVLFRPIHPVGGLRCRCPPGFTGDYCETEVDLCYSRPCGPHGRCRSREGGYTCLCRDG
YTGEHCEVSARSGRCTPGVCKNGGTCVNLLVGGFKCDCPSGDFEKPYCQVTTRSFPARSF
ITFRGLRQRFHFTLALSFATKERNGLLLYNGRFNEKHDFVALEVIQEQVQLTFSAGESTT
TVSPFVPGGVSDGQWHTVQLKYYNKPLLGQTGLPQGPSEQKVAVVTVDGCDTGVALRFGA
VLGNYSCAAQGTQGGSKKSLDLTGPLLLGGVPDLPENFPIRMRHFVGCMRNLQVDSRRVD
MADFIANNGTMPGCPTKKNVCDSNTCHNGGTCVNQWDSFSCECPLGFGGKSCAQEMANPQ
RFLGSSLVAWHGLSLPISQPWHLSLMFRTRQASGVLLQAVTRGRSTITLQLREGHVVLSV
EGTGLQASTLRLEPGRANDGDWHHAQLALGASGGPGNAILSFDYGKQRAEGNLGPRLHGL
HLSNITVGGVPGPAGGVAQGFRGCLQGVRVSETPEGVSSLDPSRGENINVETGCSLPDPC
DSNPCPANSYCSNDWDSYSCSCDPGYYGDNCTNVCDLNPCEHQSVCTRKPSAPYGYICEC
PPNYLGPYCETRIDQPCPRGWWGHPTCGPCNCDVSKGFDPDCNKTSGECHCKENHYRPSG
SSTCFLCDCYPTGSLSRVCDPEDGQCPCKPGVIGRQCDRCDNPFAEVTTNGCEVNYDSCP
RAIEAGIWWPRTRFGLPAAAPCPKGSFGTAVRHCDEHRGWLPPNLFNCTSITFSELKGFA
ERLQQNESGLDSGRSQRLALLLRNATQHTAGYFGSDVKVAYQLATRLLAHESAQRGFGLS
ATQDVHFTENLLRVGSALLDAANKRHWELIQQTEGGTAWLLQHYEAYASALAQNMRHTYL
SPFTIVTPNIVISVVRLDKGNFAGAKLPRYEALRGERPPDLETMVILPESVFREIPTMVR
PAGPSEGQESEELARRQRRHPELSQGEAVASVIIYRTLAGLLPHNYDPDKRSLRVPKRPV
INTPVVSISVHDDEELLPRALDKPVTVQFRLLETEERTKPICVFWNHSILVSGTGGWSAR
GCEVVFRNESHVSCQCNHMTSFAVLMDVSRRENGEILPLKTLTYVALGVTLAALLLTFLF
LTLLRALRSNQHGIRRNLTAALGLAQLVFLLGINQADLPFACTVIAILLHFLYLCTFSWA
LLEALHLYRALTEVRDVNAGPMRFYYMLGWGVPAFITGLAVGLDPEGYGNPDFCWLSIYD
TLIWSFAGPVAFAVSMSVFLYILAARASCAAQRQGFEKKGPVSGLQPSFAVLLLLSAAWL
LALLSVNSDTLLFHYLFAACNCIQGPFIFLSYVVLSKEVRKALKFACSRKPSPDPALTTK
STLTSSYNCPSPFADGRLYQPYGDSAGSLHSASRSGKSQPSYIPFLLREESTLNPGQGPQ
GLGDPGSLFLDGQDQQHDPDTDSDSDLSLEDDQSGSYASTHSSDSEEEEEEEEEAAFPGE
QGWDSLLGPGAERLPLHSTPKEGGPGPGKIPWPGDFGTTAKENGGSGAPEERPRENGDAL
SREGSLGPLPGTSAQPHKGILKKKCLPTISEKSSLLRVPLEQGTGSSRGSSASEGSRGGP
PPRPPPRQSLQEQLNGVMPIAMSIKAGTVDEDSSGSEFLFFNFLH
Download sequence
Identical sequences A0A286Y5A0
ENSCPOP00000014168 XP_003479250.1.53824 ENSCPOP00000014168 10141.ENSCPOP00000014168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]