SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000014186 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000014186
Domain Number 1 Region: 16-192
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 7.19e-60
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.0000000193
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000014186   Gene: ENSCPOG00000015732   Transcript: ENSCPOT00000015887
Sequence length 204
Comment pep:known_by_projection scaffold:cavPor3:scaffold_98:4261915:4273322:-1 gene:ENSCPOG00000015732 transcript:ENSCPOT00000015887 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPWASSPATTPQVERKFHVLVGVTGSVAALKLPLLVSRLLDIPGLEVIVVTTERAKHFY
SPQDVPVSLYSDTDEWEMWKRRSDPVLHIELRRWADLMLVAPLDANTLGKVASGICDNLL
TCVIRAWDHNKPLLFCPAMNTAMWEHPVTAQQVGQLKAFGYTEVPCVAKKLVCGDQGLGA
MAEVETIVEKVKEVFSQHHGIQQS
Download sequence
Identical sequences H0VU15
10141.ENSCPOP00000014186 ENSCPOP00000014186 XP_005000878.1.53824 ENSCPOP00000014186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]