SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000014190 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000014190
Domain Number 1 Region: 622-649
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.000023
Family N-acetyl transferase, NAT 0.028
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000014190
Domain Number - Region: 257-323,370-403
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.02
Family Tandem AAA-ATPase domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000014190   Gene: ENSCPOG00000015736   Transcript: ENSCPOT00000015891
Sequence length 1025
Comment pep:known_by_projection scaffold:cavPor3:scaffold_92:4613540:4646423:-1 gene:ENSCPOG00000015736 transcript:ENSCPOT00000015891 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRKKVDNRIRILIENGVAERQRSLFVVVGDRGKDQVVILHHMLSKATVKARPSVLWCYK
KELGFSSHRKKRMRQLQKKIKNGTLNIKQDDPFELFIAATNIRYCYYNETHKILGNTFGM
CVLQDFEALTPNLLARTVETVEGGGLVVILLRTMNSLKQLYTMTMDVHSRYRTEAHQDVV
GRFNERFILSLASCKKCLVIDDQLNILPVSSHAASIEALPPQAPDENLSPSSLELQELKE
SLQDTQPVGVLVDCCKTLDQAKAVLKFIEGISEKTLRSTVALTAARGRGKSAAMGLAIAG
AVAFGYSNIFVTSPSPDNLHTLFEFVFKGFDALEYQEHLDYEIIQSLNLEFNKAVIRVNV
FREHRQTIQYIHPADAVKLGQAELVVIDEAAAIPLPLVKSLLGPYLVFMASTINGYEGTG
RSLSLKLIQQLRQQSAQSQVSTTAENKTTMTARLASARTLHEVSLQESIRYAPGDAVEKW
LTDLLCLDCLNITRIISGCPLPEACELYYVNRDTLFCYHKASEVFLQRLMALYVASHYKN
SPNDLQMLSDAPAHHLFCLLPPVPPTQNALPEVLAVVQVCLEGEISRQSILNSLSRGKKA
SGDLIPWTVSEQFQDPDFGGLSGGRVVRIAVHPDYQGMGYGSRALQLLQMYYEGRFPCLE
EKVLEASQEIRTVSSEAVSLLEEVISPRKDLPPLLLKLNERPAERLDYLGVSYGLTPRLL
KFWKRAGFVPVYLRQTPNDLTGEHSCIMLKTLADEDESECESERGAWLDFRRRFLALLSY
QFSTFSPAVALNIIQNRSVGKPAQPVLGRGELDALFLPYDLKRLEMYSRNMVDYHLIMDL
IPAIARLYFLSQLGDLTLSAAQSALLLGIGLQHKSVDQLEKEIELPAGQLMGLFNRIIRK
VVKLFNDVQEKAIEEQMVAVKDVVMEPTLKTLSDDLDEAAKEFQEKHKKEVGKLKDMDLS
QYVIRGDDDEWNEVLSKAGQNASVVSLKSDKKRKSDTKQDPKQNKKLKKNRDMKNRKDMK
LKRKK
Download sequence
Identical sequences ENSCPOP00000014190 ENSCPOP00000014190 10141.ENSCPOP00000014190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]