SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000014192 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000014192
Domain Number 1 Region: 1796-2042
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.2e-52
Family Ankyrin repeat 0.0000000547
Further Details:      
 
Domain Number 2 Region: 570-701
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000541
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 3 Region: 388-512
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000706
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 4 Region: 887-928
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000383
Family EGF-type module 0.0053
Further Details:      
 
Domain Number 5 Region: 758-891
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000596
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 6 Region: 1128-1244
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000942
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 7 Region: 924-967
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000123
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 8 Region: 733-769
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000181
Family EGF-type module 0.0045
Further Details:      
 
Domain Number 9 Region: 989-1129
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000204
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 10 Region: 508-550
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000212
Family EGF-type module 0.0053
Further Details:      
 
Domain Number 11 Region: 121-163
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000466
Family EGF-type module 0.014
Further Details:      
 
Domain Number 12 Region: 236-283
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000393
Family EGF-type module 0.019
Further Details:      
 
Domain Number 13 Region: 158-195
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000214
Family EGF-type module 0.0057
Further Details:      
 
Domain Number 14 Region: 692-735
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000214
Family EGF-type module 0.012
Further Details:      
 
Domain Number 15 Region: 41-81
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000219
Family EGF-type module 0.014
Further Details:      
 
Domain Number 16 Region: 262-395
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000022
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 17 Region: 197-240
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000666
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 18 Region: 1240-1284
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000121
Family EGF-type module 0.0072
Further Details:      
 
Domain Number 19 Region: 1281-1320
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000139
Family EGF-type module 0.013
Further Details:      
 
Domain Number 20 Region: 84-120
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000196
Family EGF-type module 0.012
Further Details:      
 
Domain Number 21 Region: 1400-1432
Classification Level Classification E-value
Superfamily Notch domain 0.000000288
Family Notch domain 0.0014
Further Details:      
 
Domain Number 22 Region: 1479-1510
Classification Level Classification E-value
Superfamily Notch domain 0.000000314
Family Notch domain 0.0034
Further Details:      
 
Domain Number 23 Region: 1352-1391
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000315
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 24 Region: 4-41
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000435
Family EGF-type module 0.018
Further Details:      
 
Domain Number 25 Region: 963-994
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000794
Family EGF-type module 0.006
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000014192
Domain Number - Region: 1442-1473
Classification Level Classification E-value
Superfamily Notch domain 0.00131
Family Notch domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000014192   Gene: ENSCPOG00000015738   Transcript: ENSCPOT00000015893
Sequence length 2447
Comment pep:known_by_projection scaffold:cavPor3:scaffold_2:44454241:44557644:-1 gene:ENSCPOG00000015738 transcript:ENSCPOT00000015893 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALQCRDDYEPCVNEGICVTYHNGTGYCKCPEGFLGEYCQHRDPCEKNRCQNGGTCVAQAM
LGRATCRCALGFTGEDCQYSTSHPCFVNPPCQNGGTCHMLSWDTYECTCQVGFTGKLCQW
IDACLSQPCANGSTCTTVANQFSCKCLAGFTGQKCETDVNECDIPGQCQNGGTCLNLPGS
YQCQCSQGFTGQHCDNPYVPCAPSPCVNGGTCRQTGDFTFECSCLPGFEGSTCERNIDDC
PNHRCQNGGVCVDGVNTYNCRCPPQWTGQFCTEDVDECLLQPNACQNGGTCTNRNGGYGC
VCVNGWSGDDCSENIDDCAFASCTPGSTCIDRVASFSCMCPEGKAGLLCHLDDACISNPC
HKGALCDTNPLNGHYICTCPQGYKGADCTEDVDECAMTNSNPCEHAGKCVNTDGAFHCEC
LKGYAGPRCEMDINECHSDPCQNDATCLDKIGGFTCLCMPGFKGVHCEIEINECQSNPCV
NNGQCVDKVNRFQCLCPPGFTGPVCQIDIDDCSSTPCLNGAKCIDHPNGYECQCATGFTG
LLCEENIDNCDPDPCHHGQCQDGIDSYTCICNPGYMGAICSDQIDECYSSPCLNEGRCID
LVNGYQCNCQPGTSGVNCEINFDDCASSPCVNGTCVDGISRYSCVCSPGFTGQRCNVDID
ECASNPCRKGATCINDVNGFRCICPEGPHHPSCYSQVNECLSNPCIHGSCIGGLSGYKCL
CDAGWVGINCEVDKNECLSNPCQNGGTCDNLVNGYKCTCKKGFKGYNCQVNIDECASNPC
LNQGTCFDDVSGYTCQCALPYTGKNCQTVLAPCSPNPCENAAVCKEAPNFESFTCLCAPG
WQGQRCTVDIDECVSKPCMNHGLCHNTQGSYMCECPPGFSGMDCEEDINDCLANPCQNGG
SCVDGVNTFSCMCLPGFIGDKCQTDMNECLSEPCKNGGTCSDYVNSYTCKCQAGFDGVHC
ENNIDECTDSSCFNGGTCVDGINSFSCLCPVGFTGPFCLHEINECSSHPCLNEGTCVDGL
GTYRCTCPLGYTGKNCQTLVNLCSQSPCKNKGTCIQEKAESRCLCPSGWTGAYCDVPNVS
CDVAALNKGVLAKNLCKNSGACINAGNTHHCQCPLGYTGSYCEQQLDECASNPCKHGATC
TDFIGGYRCECVPGYQGVNCEYEVDECQNQPCRNGGTCVDLVNHFKCSCPPGTRGLFCEE
NIDDCAGGPHCLNGGQCVDRIGGYSCRCLPGFAGERCEGDINECLSNPCNSEGSLDCIQL
TNNYQCVCRSTFTGRHCETFVDVCPQKPCLNGGTCAVASNMPDGFICRCPPGFSGAKCQS
SCGQVKCRKGEQCVHTAAGPRCFCPSPQDCESGCASSPCQHGGSCYPQRQPPYYSCHCSV
PFGGNHCQFYMAPTSIPSDICASQYCADKARDGVCDEVCNSHACQWDGGDCSLTMEDPWA
NCSSPLPCWNYINNQCDELCNTAECLFDNFECQGNSKTCKYDKYCADHFKDNHCDQGCNS
EECGWDGLDCAADQPENLAEGTLVIVVLMPPEQLLQDARSFLRALGTLLHTNLRIKLDSQ
GLPMVYPYYGEKSAAMKKQKLSRRSLPDEQEQEVAGSQVFLEIDNRQCVQDSEQCFKNTD
AAAALLASHAIQGTLSYPLVSVVSESLSPKPTPLLYLLAVAVVFILFIILLGVIMAKRKR
KHGSLWLPEGFTLRRDSSNHKRREPVGQDAVGLKNLSVQVSEANLIGSGTSEHWVDDEGP
QPKKAKAEDEALLSEEEDPIDRRPWTQQHLEAADIRRTPSLALTPPQAEQEVDVLDVNVR
GPDGCTPLMLASLRGGSSDMSDEDEDGEDSSANIITDLVYQGASLQAQTDRTGEMALHLA
ARYSRADAAKRLLDAGADANAQDNMGRCPLHAAVAADAQGVFQILIRNRVTDLDARMNDG
TTPLILAARLAVEGMVAELINCQADVNAVDDHGKSALHWAAAVNNVEATLLLLKNGANRD
MQDNKEETPLFLAAREGSYEAAKILLDHFANRDITDHMDRLPRDVARDRMHHDIVRLLDE
YNVTPSPPGTVLTSALSPVICGPNRSFLSLKHTPMAKKSRRPNAKSTMPTSLPNLAKEAK
DAKGSRRKKSLSEKVQLSESSVTLSPVDSLESPHTYVSDTTSSPMITSPGILQASPNPML
AAAAPQAPVHAQHALSFPNPHEMQPLAPGASTVLPSVSQLLSHHHIVPPGSSSAGNLSRL
HPVTVPADWMNRMEMSDTQYNEMFGMVLTPAEGTHPGIAPQSRPPEGKHVPTPRETLPPI
VTFQLIPKGSIAQPAGASQPQSTCPPAVAGPLPTMYQIPEMARLPGVAFPTAMMPQQDGQ
VAQTILPAYHPFPASVGKYPTPPSQHSYASSNAAERTPNHSGHLQGEHPYLTPSPDSPDQ
WSSSSPHSASDWSDVTTSPTPGSGGGGQRGPGTHMSEPPHSNMQVYA
Download sequence
Identical sequences ENSCPOP00000014192 10141.ENSCPOP00000014192 ENSCPOP00000014192

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]