SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000014204 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000014204
Domain Number 1 Region: 9-128,320-628
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.07e-64
Family Integrin alpha N-terminal domain 0.0000549
Further Details:      
 
Domain Number 2 Region: 148-343
Classification Level Classification E-value
Superfamily vWA-like 4.19e-52
Family Integrin A (or I) domain 0.0000000298
Further Details:      
 
Domain Number 3 Region: 914-1116
Classification Level Classification E-value
Superfamily Integrin domains 3.35e-34
Family Integrin domains 0.0037
Further Details:      
 
Domain Number 4 Region: 772-909
Classification Level Classification E-value
Superfamily Integrin domains 1.31e-27
Family Integrin domains 0.0023
Further Details:      
 
Domain Number 5 Region: 631-770
Classification Level Classification E-value
Superfamily Integrin domains 4.34e-17
Family Integrin domains 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000014204   Gene: ENSCPOG00000015751   Transcript: ENSCPOT00000015906
Sequence length 1162
Comment pep:known_by_projection scaffold:cavPor3:scaffold_29:8850213:8916274:-1 gene:ENSCPOG00000015751 transcript:ENSCPOT00000015906 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GFLNCCLAYNVGLSEAKIFSGPSSEQFGYSVQQFINPKGNWILVGSPWSGFPENRMGDVY
KCPVDLSTATCEKLNLQTSTSIQNVTEVKTNMSLGLTLRRNTGTGGFLTCGPLWAQQCGS
QYYTTGVCCDISPDFQHLASFAPAIQTCPSFVDVVVVCDESNSIYPWEAVKNFLEKFVQG
LDIGPRKTQVALIQYANDPRVVYNLNTFKTKDEMIRATSQTYQAGGDLTNTFKAIQFART
NAYSAASGGRPGATKVMVVVTDGESHDGSMLKSVIEQCNNDNILRFGIAVLGYLNRNALD
TKNLIKEIKSIASIPTERFFFNVADEAALLEKAGTIGEHIFSIEGTVQGGENIQLEMSQV
GFSADYSPQNDILMLGAVGAFAWSGTIVQETAHGHTIFPKETFDQILQDRNHSSYLGYSV
AAISTEKSVYFVAGAPRANYTGQIILYNLDEHGNVTIIQTHRGDQIGSYFGSVLCSVDVN
KDTITDVLLVGAPTYMNDLKKEEGRVYLFTIAKGILNQHQFLEGPEGIENARFGSAIAAL
SDINMDGYNDVIVGSPLENQNSGAVYIYNGDQGTIRTKYSQKILGSDRAFRSQLQFFGRS
LDGYGDLNGDSITDVSIGAFGQVVQLWSQSIADVSVEASFNPEKIILFNKNAQIVLQLCF
RAKFRPTRQNSQVAITYNITLDADGYSSRVTSRGLFQENNERCLQKNMVLNVENRCTQHT
IQIQQKPSDVVNSLDLRVDISLENPGSSPALEAYSDTVKVFSIPFYKDCGGDGICISDLV
LDVQQLPATQKQSYIVSNQNKMLTFSVTLKNKGESAYNTAIVANFSENLFFASYSMPVDG
TEVICQVDSSQRSVTCDVGYPALKSKQQVTFTIHFDFNLQNLQNQASFSFQAFSESEEAN
KADNSVNLKIPLLYDAEIHLTRSTNINFYEVSSHKNVPSVVHYFEDIGPKFIFSLKVTTG
LVPVSMASVIIHIPQYTKEKNPLMYLTDIHTDQAGDISCSRINPLKLGQTSSSVSFKEEN
FRHVKRIVDCRTASCSDVICMFKNLDIKEEYFINVSTRIWSRDFRCKSTFQTVQLTAAAE
INTYNPEIYVIEENTVTIPLMIMKPNEKAEVPTGVIVGSVIAGILLLAALVSVLWRQRMS
KSSYEISPRNPDEMDESTELHS
Download sequence
Identical sequences ENSCPOP00000014204 ENSCPOP00000014204 10141.ENSCPOP00000014204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]