SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000014227 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000014227
Domain Number 1 Region: 2066-2216
Classification Level Classification E-value
Superfamily Growth factor receptor domain 9.26e-20
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 2 Region: 1073-1200
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.04e-17
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 3 Region: 916-982
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.22e-17
Family TB module/8-cys domain 0.00096
Further Details:      
 
Domain Number 4 Region: 2004-2075
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.49e-17
Family TB module/8-cys domain 0.0000949
Further Details:      
 
Domain Number 5 Region: 1802-1927
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.92e-17
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 6 Region: 1481-1554
Classification Level Classification E-value
Superfamily TB module/8-cys domain 9.16e-16
Family TB module/8-cys domain 0.0000748
Further Details:      
 
Domain Number 7 Region: 2289-2357
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000301
Family TB module/8-cys domain 0.00058
Further Details:      
 
Domain Number 8 Region: 288-353
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000000000034
Family TB module/8-cys domain 0.0017
Further Details:      
 
Domain Number 9 Region: 1363-1490
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000895
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 10 Region: 2446-2572
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000298
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 11 Region: 184-269
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000000000647
Family TB module/8-cys domain 0.0018
Further Details:      
 
Domain Number 12 Region: 1201-1325
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000173
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 13 Region: 2175-2298
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000738
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 14 Region: 1560-1615
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000267
Family EGF-type module 0.0011
Further Details:      
 
Domain Number 15 Region: 2401-2455
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000586
Family EGF-type module 0.0062
Further Details:      
 
Domain Number 16 Region: 1964-2017
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000268
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 17 Region: 1644-1705
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000301
Family TB module/8-cys domain 0.001
Further Details:      
 
Domain Number 18 Region: 1030-1064
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000447
Family EGF-type module 0.0012
Further Details:      
 
Domain Number 19 Region: 2365-2409
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000503
Family EGF-type module 0.017
Further Details:      
 
Domain Number 20 Region: 1920-1962
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000867
Family EGF-type module 0.01
Further Details:      
 
Domain Number 21 Region: 1717-1762
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000232
Family EGF-type module 0.0041
Further Details:      
 
Domain Number 22 Region: 494-539
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000311
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 23 Region: 878-930
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000046
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 24 Region: 735-778
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000461
Family EGF-type module 0.013
Further Details:      
 
Domain Number 25 Region: 2562-2652
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000471
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 26 Region: 1604-1644
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000261
Family EGF-type module 0.01
Further Details:      
 
Domain Number 27 Region: 409-463,509-542
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000267
Family Growth factor receptor domain 0.019
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000014227
Domain Number - Region: 994-1034
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00115
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000014227   Gene: ENSCPOG00000021546   Transcript: ENSCPOT00000027611
Sequence length 2799
Comment pep:known_by_projection scaffold:cavPor3:scaffold_195:294949:350368:-1 gene:ENSCPOG00000021546 transcript:ENSCPOT00000027611 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGAGGLNMAWGPPAPLLLAWVALSCVAGGIGHWDRAVGPAGAGRVRRRGSPSVLQGPNVC
GSRFHAYCCPGWRTLPGGSQCVVRECWCHQEVGVQAQPNLCTCEPAAAAPSAVSKCRVNC
VSRGSCRECLCQSGYVGVGFCGSPCHPPRPSTAVCDHGCHDGGRCIGPNHCARVCGFLGS
QCERDYRTGPCFSQGGPEGCQHRLTGLVCTRALCCATVGQAWGLPCELCPPQPHPCRRGF
LLNIHTGACQDVDECRAIPGLCQGGTCVNSVGSFECRCPPGHRLSASGVMCEDLRRGTCF
LVLFGGRCAVDLLGHYTRRQCCCDGGQCWAAGSAPELCPPRGSDGFQRLCVQGVLPPTAH
LGPLPAFPGFQSSGRGPALGPAPHGPYGSSGRGVPRPGPVNSHVGTATLNQTGNVCHHFT
DLCPNGRCLPTPSSYRCECKPGYSLDGRGVCIVVGECTSSSPQRPWYCQGHQGCPATLAR
LATRCAPPLTARLLPPDVDECVGGGSGLCRLGRCVNTEGSFRCVCSVGFELSPDGKSCVG
ECLVSLFCLRGSALNSPGGRILSLLVIHLFLLMHDSYIIKSTSLCSAAVGWASSRCSGYS
GPSRSHCGPGRTAAARGRTAWQRFIPTQSWKEEERLRPSGGGTGPWPGCLLPSECFLSPP
VPWFGVECFLCPSRSAKAWDRGCGAGLRRPPGSQGSCISSGCTHQRLCPWPRGLCSSYGC
THSLGYQAGATVKDHTHVDECALNASLCDHGQCRNSPGSYTCSCPQGFTFRQDTETCEGC
THTCLDIHAVGGLCTNGHMQAESLCVPLFTHTRDIPLPQSCPCHDSLEGPCYPLCIMGPS
RWPSCMGALILGFAGQLGLLEPSEEQPAGPQHPLLTPPDVNECESFPGECWSGRCINTEG
SFLCECSLGWSLDALGRGCVDVRLEPCFLHPGEGDCGVPLPGKYRKDVCCCSVGAAWGAE
CESCPEPDSPEFPSLCPRGRGFSGHDLLSGRPMYQDVDECGAFPGLCARGSCRNTAGGFA
LDARERSCRDIDECRISPDLCGQGTCVNTPGSFQCRCFRGYASGPLLMRSCVDPDVDECA
RDPLLCRGGTCTNTDGSYECQCPPGHTLTAEGTACEDVDECALSSSLCPHGRCINVVGAF
QCSCDAGFRASPDRQRCVDADECGVRNGGCAVHCVNTEGSFRCGCGQGYALLPDGRACAD
VDECKENPDICGQGQCANVPGAHRCLCNDGFTATPDMKTCVDVNECDLNPHICLHGNCEN
TAGSFVCHCQLGYITRKGATGCSDVDECELGGHNCDGHASCLNVPGSYRCACQQGFTGDG
FSCEGQARAPLCPPGGLRQSPLSWRLTARVPVIGTSSHASDRDECAEDMDLCENGQCLNV
PGGYRCECEMGFGPTEDHGGCQDVDECALGNFCAFGSCENLPGFFRCACADGYALDRGGG
NCTDVNECADPVNCINGLCVNTPGSYLCRCPRDFELNPSGVGCVDPRAGSCFLDTHDRGD
GGLSCGAEVGAGVTRASCCCSLGRAWGSPCELCPTANSTEYRTLCPGGEGFRPNLLTVIL
EDIDECQELPGLCQGGNCVNTFGSFQCECLPGYHLHQETRRCEDIDECSGHSGICGPGTC
YNTLGNYTCVCPAEYLQVNGGNNCMADMRKSSCFRRYNGTCGNELAFTVTRKLCCCAYNV
GQAWNRPCEASVLLCPADYQLLCGNQVPGFAVDVHTGAPTDIDECGEIPGLCTRGVCINQ
IGSFHCDCPLGFEYDSALLACKGVQGLILCSCALSHPYLREPGSVTCWTQVGHGSTPLGA
CLRQNECQEIPHVCIHGDCVDTEGSYICLCHRGFRASTDGTLCVDLDECKQQPCGNGTCR
NTVGSYTCLCSPGFTATRSGNCVDIDECRTMAGQVCPMGQCLNTAGSFHCLCQGGFELAP
DGKNCVDTNECLTLTGTCLPGTCQNLQGSFRCICPPGFQVQSNHCVDINECLEEPNLCLF
GTCTNSPGSFQCLCPLGFILSDHGHRCFDTRQSVCFTRFEAGKCSAPKALNTTKTRCCCS
RSPGEGWGEPCELCPQEGGAAFQELCPFGYGVVPGPGDAREDVDECAENPGVCGHGLCVN
TDGSFRCQCPSGYSLDPAGLGCVDTDECSAGKPCGEGTCTNVIGGFQCTCAVGFEPGPAA
TCKDIDECSLNPLLCAFRCRNTEGSYLCTCPAGYALREDGATCRDVDECADTSQDCQARG
MLCKNLIGTFECICPVGMRPQPGSGEGCTDEDECHTQPSICTHGHCVNTVGSFRCDCHKG
FQPSPTLTECLDVRQGLCFSEVLQAVCLAHWSSGEAVSRAMCCCGGGRGWGPSCELCPLP
STSAYKKLCPHGSGYSAEGRDVDECRVLAHLCTHGECINSIGSFHCHCQAGYRPDTTATA
CLDVDECSQDPKPCSFHCKNTEGSFLCTCPRGYLLEEDGQACKDLDECSTRQHNCQFLCV
NTVGAFTCRCPPGFTQRQQACFDNNECLAQPSPCGTRGRCLNAPGSFHCECYQGFTLDSS
GHGCKDVDECDEPHRCRHGCQNEVGGYRCSCPQGFTQHSQWAQCVDENKCAVSPAACGSA
SCHNTLGGFHCVCPSGFDFDETLGGCQDVDECAGQGSPCSYSCANMEGGFLCGCPQGYFR
AGQGHCVSALGFSPGPQEAPEEEPLSPEACYECKINGLTPRDRPPRSVHEGHQLSMATLD
AEVPLTLGLKLSCLTQAEHILELRPALQGQGVRYVVARGNGQSFFRMVHRSGLSSLQLGP
RRPGPGKYQLEVVSVAGSQGSPHGPQGRALWLKVQLQLL
Download sequence
Identical sequences 10141.ENSCPOP00000014227 ENSCPOP00000014227 ENSCPOP00000014227

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]