SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000014247 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCPOP00000014247
Domain Number - Region: 32-114
Classification Level Classification E-value
Superfamily Integrin domains 0.0256
Family Integrin domains 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000014247   Gene: ENSCPOG00000020276   Transcript: ENSCPOT00000021205
Sequence length 158
Comment pep:novel scaffold:cavPor3:scaffold_248:9169:9642:-1 gene:ENSCPOG00000020276 transcript:ENSCPOT00000021205 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGIRSTKLHHLLCSLTQLTLCGMWMGINPPYIDTDAHSEHGHIIIMCNKGSLTAFYCVLG
YLGSLALLSFTVAFLARNLPDTFNEAKFLTFSMLVFCSVWVTFLPVYYSSKVYYRKVMVA
MEVFSILASNAGLLSCIFLPKCCIVLRRSEHNTLTGFK
Download sequence
Identical sequences 10141.ENSCPOP00000014247 ENSCPOP00000014247 ENSCPOP00000014247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]