SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000014319 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000014319
Domain Number 1 Region: 189-228
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000017
Family EGF-type module 0.0075
Further Details:      
 
Domain Number 2 Region: 146-187
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000176
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 3 Region: 110-154
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000227
Family EGF-type module 0.018
Further Details:      
 
Domain Number 4 Region: 69-112
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000406
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000014319
Domain Number - Region: 41-77
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00347
Family EGF-type module 0.042
Further Details:      
 
Domain Number - Region: 13-36
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0237
Family EGF-type module 0.053
Further Details:      
 
Domain Number - Region: 283-315
Classification Level Classification E-value
Superfamily CbiD-like 0.0301
Family CbiD-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000014319   Gene: ENSCPOG00000026382   Transcript: ENSCPOT00000019668
Sequence length 361
Comment pep:known_by_projection scaffold:cavPor3:scaffold_111:799868:805303:1 gene:ENSCPOG00000026382 transcript:ENSCPOT00000019668 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASGAECDPPCDPKNGFCEDDSVCRCQPGWQGPQCEQCVTAPGCANGHCEEAWDCICEDGW
DGKLCDLDVRACISIPCDNNGTCMDLGNGNYECACVPGFSGKDCQKKDGPCAIHGSPCQH
GGTCEDDEGQAFHASCLCPPGFSGNFCEIMTNSCIPNPCENDGVCTDIGGDFRCRCPAGF
IDKTCSRPVAACTSSPCLNGGTCLQHSQVSYECLCKPPFAGPTCAKKRVVGVPSGYSLPY
RVTPGVHELPLPKPEHRVLKVSMKRLNKNTPLLTEGQAVCFTILGVLTGLVVLGTVGIIF
LNKCETWVSNLRYNSMLRKKKNLLLQYNSGEDLAVNIIFPEKIDMTTFRKEAVVVSGEEE
I
Download sequence
Identical sequences ENSCPOP00000014319 ENSCPOP00000014319 10141.ENSCPOP00000014319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]