SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000014412 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000014412
Domain Number 1 Region: 2-88,199-225,259-313
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.35e-17
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000288
Further Details:      
 
Domain Number 2 Region: 318-419
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00000000000119
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.0000179
Further Details:      
 
Domain Number 3 Region: 143-232
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000013
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000845
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000014412   Gene: ENSCPOG00000026285   Transcript: ENSCPOT00000020049
Sequence length 421
Comment pep:novel scaffold:cavPor3:scaffold_42:6826532:6827890:-1 gene:ENSCPOG00000026285 transcript:ENSCPOT00000020049 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AYNYLVIKVGSGGLASNRQAAELGTGAPVVDSHKLSGTCVNARCIPKRVVWNTAIHSKFV
HDHVDYGFQSCESKFNWYVIKEKQDTYMSRLFTIYQNNLAKYHGYASFTNDPQPTAEVSG
EKNTPHSLITTGGVTSLPHESQIAGASLGITSEGFFSWKNCQGTVIVGVSYIAVEIATIL
STLGSKTAFMIQHDKLRNFDSLLSSNCTEGLENAGMEVLKYSQVKEVSMGLELNVVTAVP
GRPTLMTISDAHCLLGAIEWDPISKGLNLDKLGIQTDEKGHIIVDEFQNISVKGTYTFGD
MCRKALPTPVPTAAGLDYDNTCTVVFSHPIGTVRLMEDEGIHKYGKANDKTLASMYHAMT
TRKTCVMQMICANKGDKVLGPKCRELAVSFATAVKMGPTKADFDNTTAIHPTSSEELVLF
T
Download sequence
Identical sequences ENSCPOP00000014412 10141.ENSCPOP00000014412 ENSCPOP00000014412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]