SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000014573 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000014573
Domain Number 1 Region: 438-567
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000628
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 2 Region: 629-671
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000838
Family EGF-type module 0.005
Further Details:      
 
Domain Number 3 Region: 820-856
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000041
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 4 Region: 663-704
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000485
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 5 Region: 374-416
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000167
Family EGF-type module 0.01
Further Details:      
 
Domain Number 6 Region: 782-824
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000017
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 7 Region: 746-786
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000142
Family EGF-type module 0.015
Further Details:      
 
Domain Number 8 Region: 338-378
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000187
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 9 Region: 297-341
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000065
Family EGF-type module 0.01
Further Details:      
 
Domain Number 10 Region: 707-745
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000727
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000014573
Domain Number - Region: 593-629
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000401
Family EGF-type module 0.066
Further Details:      
 
Domain Number - Region: 414-445
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0311
Family EGF-type module 0.011
Further Details:      
 
Domain Number - Region: 265-298
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0473
Family EGF-type module 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000014573   Gene: ENSCPOG00000022187   Transcript: ENSCPOT00000027852
Sequence length 1218
Comment pep:known_by_projection scaffold:cavPor3:scaffold_8:14927662:14960640:1 gene:ENSCPOG00000022187 transcript:ENSCPOT00000027852 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KEGERERRKESRELSLLLALLCALRTKVCGASGQFELEILSMQNANGELQNGNCCGGARN
PGDRKCTRDECDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNSFNLKASRGNDRNRI
VLPFSFAWPRSYTLLVEAWDSSNDTVQPDSIIEKASHSGMINPSRQWQTLKQNTGVAHFE
YQIRVTCDDYYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPECNKAICRQGCSP
KHGSCKIPGNCRCQYGWQGLYCDKCIPHPGCVHGTCIEPWQCLCETNWGGQLCDKDLNYC
GTHQPCLNGGTCSNTGPDKYQCSCPEGYSGPNCEIAEHACLSDPCHNGGSCKETSLGFEC
ECSPGWTGPTCSTNIDDCSPNNCSHGGTCQDMVNGFKCVCPPQWTGKTCQLDANECEAKP
CVNAKSCKNLIASYYCDCLPGWMGQNCDININDCLGQCQNDASCQDLVNGYRCICPPGYA
GDHCERDIDECASNPCLNGGHCQNEINRFQCLCPTGFSGNLCQLDIDYCEPNPCQNGAQC
YNRASDYFCKCPQDYEGKNCSHLKDHCRTTPCEVIDSCTVAMASNDTPEGVRYISSNVCG
PHGKCKSQSGGKFTCDCNKGFTGTYCHENINDCESNPCRNGGTCIDGVNSYKCICSDGWE
GAYCETNINDCSQNPCHNGGTCRDLVNDFYCDCKNGWKGKTCHSRDSQCDEATCNNGGTC
YDEGDAFKCMCPGGWEGTTCNIARNSSCLPSPCHNGGTCVVNGESFTCVCKEGWEGPICT
QNTNDCSPHPCYNSGTCVDGDNWYRCECAPGFAGPDCRININECQSSPCAFGATCVDEIN
GYRCVCPPGHTGAKCQEVSGKPCITMGSMIPDGAKWDDDCNACQCLNGRIACSKVWCGPR
PCLVHRGHSECPSGQSCIPILDDQCFVRPCTGVGECHSSSLQPVKTKCTSDSYYQNNCAN
ITFTFNKEMMSPGLTTEHICSELRNLNILKNVSAEYSIYIACEPSPSANNEIHVAISAED
IRDDGNPIKEITDKIIDLVSKRDGNSSLIAAVAEVRVQRRPLKNRTDFLVPLLSSVLTVA
WICCLVTAFYWCVRKRRKPSSHTLSASEDNTTNNVREQLNQIKNPIEKHGANTVPIKDYE
NKNSKMSKIRTHNSEVEEDDMDKHQQKARFAKQPVYTLVDREEKPPNGTPTKHPNWTNKQ
DNRDLESAQSLNRMEYIV
Download sequence
Identical sequences ENSCPOP00000014573 10141.ENSCPOP00000014573 ENSCPOP00000014573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]