SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000014638 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000014638
Domain Number 1 Region: 38-211
Classification Level Classification E-value
Superfamily Lysozyme-like 1.91e-24
Family G-type lysozyme 0.00000532
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000014638   Gene: ENSCPOG00000026898   Transcript: ENSCPOT00000024059
Sequence length 211
Comment pep:known_by_projection scaffold:cavPor3:scaffold_24:3186779:3193846:-1 gene:ENSCPOG00000026898 transcript:ENSCPOT00000024059 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPSILLVGLVALIGKSRSSYPFPHALRPHLHPRLYHGCYGDIMTMETAGVRCDISNLLT
CGIRGSEMFADMDLRSIRPYQTLIKEVGQKYCVDPALIAAVISRESHGGTALQRGWDSRG
LKFGLMQVDKRFQPTGAWDSKEHLSQAVDILAENIKAMRRKFPTWSVDQHLKGGLSAFKS
GAEAIATLEDIDSDYADDVVARARFYRSHGF
Download sequence
Identical sequences H0VVB2
ENSCPOP00000014638 10141.ENSCPOP00000014638 ENSCPOP00000014638 XP_003471621.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]