SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000014676 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000014676
Domain Number 1 Region: 409-545
Classification Level Classification E-value
Superfamily TIMP-like 2.59e-23
Family Netrin-like domain (NTR/C345C module) 0.021
Further Details:      
 
Domain Number 2 Region: 188-284
Classification Level Classification E-value
Superfamily Immunoglobulin 2.79e-21
Family I set domains 0.021
Further Details:      
 
Domain Number 3 Region: 360-416
Classification Level Classification E-value
Superfamily BPTI-like 1.56e-20
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0019
Further Details:      
 
Domain Number 4 Region: 109-159
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000126
Family Ovomucoid domain III-like 0.039
Further Details:      
 
Domain Number 5 Region: 311-356
Classification Level Classification E-value
Superfamily BPTI-like 0.0000000227
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.039
Further Details:      
 
Domain Number 6 Region: 29-79
Classification Level Classification E-value
Superfamily Elafin-like 0.000000301
Family Elafin-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000014676   Gene: ENSCPOG00000025782   Transcript: ENSCPOT00000024516
Sequence length 552
Comment pep:known_by_projection scaffold:cavPor3:scaffold_4:20606041:20608433:1 gene:ENSCPOG00000025782 transcript:ENSCPOT00000024516 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTLQLLLLFLPLFLIVQLTSGVSLLPEPGSHPGVCPNQLSPSLWVDAQSTCERDCTGDQ
DCTAAEKCCTNVCGLHSCVAARFPDGGPTAPVTAASCEGFECPQQGSDCDIWDGQPVCRC
RDRCEKEPSFTCASDGLTYYNRCYMDAEACLHGLHLHIVPCKHILSWPPSSPGPPETTAR
PTPEAALMPPALYNSPSPQAVHVGGTASLHCDVTGRPPPAVTWEKQSHQRENLIMRPDQM
YGNVVVTSIGQLVLYNARPEDAGLYTCTARNAAGLLRADFPLSVVQREPAREGTSGTLAL
AKCLPDLQACAGSTSANQVLWYFDSQRGGCMTFPAFECAGATQGFTTYEACQQACVQGPR
DACMLPAVQGPCQGWELRWAYNPVLQQCQPFAYGGCEGNGNNFESRESCEEVCPVPRSPP
CRACRLRSKLVLSLCRSDFAIVGRLTEVLEEPEVGGGIARVALDDVLKDDKMGLKLLGTK
YLEVTLSGMDWACPCPNVTASDELLIIMGEVHDGVAMLDAGSYVRAASEKRVKKILELLE
KKACELLIRFQD
Download sequence
Identical sequences H0VVF0
ENSCPOP00000014676 10141.ENSCPOP00000014676 ENSCPOP00000014676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]