SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000015068 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCPOP00000015068
Domain Number - Region: 33-109
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00589
Family Sfri0576-like 0.059
Further Details:      
 
Domain Number - Region: 124-291
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 0.0321
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000015068   Gene: ENSCPOG00000006967   Transcript: ENSCPOT00000022844
Sequence length 365
Comment pep:novel scaffold:cavPor3:scaffold_7:19451162:19480695:-1 gene:ENSCPOG00000006967 transcript:ENSCPOT00000022844 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LITENCHTIATCINITLFSFFAGNQLTSCKNHILEFKENILHLKSTNKHNHEELLKTLTE
MTHEIMQRGNQSENLDEKETDTPSKEETISNLFEDFKFFLPHLRKVKRIYPEVLIGQGKT
GVSFAVGIPTTSRGNHTYLKQTLNSVVSRMTPWEEKDAVVIVSVADSNEDYVKSVVDMVR
KRFKRQVKSGTLEVISVPDFFYPSVIHEENLTKNVKNSWRIKQVLDFSVLMAYAQPKATY
YLQLEDDIIAKKMYFTKLTEFIKNMTSNDWFCVQFSVLGFIGKLFKSKDLPEFVHFFLMF
YEERPIDLLVDEIFHIKICDAGEPLEQCLKRKTQVRINYRPSLFQHVGIHSSLPQREQFL
KVRFL
Download sequence
Identical sequences ENSCPOP00000015068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]