SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000015069 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000015069
Domain Number 1 Region: 81-201
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.27e-24
Family N-acetyl transferase, NAT 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000015069   Gene: ENSCPOG00000011206   Transcript: ENSCPOT00000011312
Sequence length 227
Comment pep:novel scaffold:cavPor3:scaffold_37:15453366:15454049:-1 gene:ENSCPOG00000011206 transcript:ENSCPOT00000011312 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPYHIRTFQEKDQTPVMDLYSSCFVEHVPAAIRHALMLPRNLLLEVGVALFVFLVSGSW
LLAVISILILLLFLCFLVRYMWKHAIVICLRTDMADITKTYLSAHDSCFWVAESGGQVVG
IVSALLVANPPLGKKQLKLFHLAVAMEHRGEGIAKALVRTVLQFARDQGYGEVVLDTTAV
QHSALGLYQGMGFRKTGQFFESILWKLTGISWIRLIYHLPSARDGGL
Download sequence
Identical sequences ENSCPOP00000015069 10141.ENSCPOP00000015069 XP_005003405.1.53824 XP_005003406.1.53824 XP_005003407.1.53824 XP_013007026.1.53824 ENSCPOP00000015069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]