SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000015084 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000015084
Domain Number 1 Region: 41-164
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 6.95e-33
Family Myeloperoxidase-like 0.000000338
Further Details:      
 
Domain Number 2 Region: 1-38
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000192
Family EGF-type module 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000015084   Gene: ENSCPOG00000001983   Transcript: ENSCPOT00000025481
Sequence length 164
Comment pep:known scaffold:cavPor3:scaffold_12:34213818:34215836:1 gene:ENSCPOG00000001983 transcript:ENSCPOT00000025481 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NPCCSNPCQNRGECLSVGFDRYKCDCTRTGYYGENCTTPEFLTRIKLLLKPTPNTVHYIL
THFKGVWNIVNNIPFLRNAIMKYVLTSRSHLIDSPPTYNAHYGYKSWEAFSNLSYYTRAL
PPVADDCPTPMGVKGKKELPDSNEVLEKVLLRRKFIPDPQGTNM
Download sequence
Identical sequences Q8K3U5
ENSCPOP00000015084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]