SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000015212 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000015212
Domain Number 1 Region: 42-273
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 8.9e-38
Family Hypothetical protein cg14615-pa 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000015212   Gene: ENSCPOG00000024270   Transcript: ENSCPOT00000019971
Sequence length 295
Comment pep:novel scaffold:cavPor3:scaffold_86:1517561:1534488:1 gene:ENSCPOG00000024270 transcript:ENSCPOT00000019971 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFHVQSPQMLQMLEKSLVKNLPEAIKVYGTVFHMNQGNPFKVKALVDKWPDFNTVVVRPQ
EQEMTDDLDHYTNTYQIFSKDPKNCHEFLEKPDVINWKQHLQIQSAQSSLDEVIQSLAAT
KLVKVKKTQCILYMMPPTVKKLVPSLLDTQHLHPKSEIPRIINQEMFKLSSLDVAHAALV
NKFWSFGGNERSQRFIERCIQTFPSFCLLGPEKTPVTWTMMDYTGELRMGATVPEYRGLG
LMSYISYIETKSLEKLGFPMYSHVDKANKAVQKISDNLRHVTMPCDWNQWNCMPL
Download sequence
Identical sequences A0A286XZE9
ENSCPOP00000015212 XP_003464217.1.53824 XP_013001899.1.53824 XP_013001901.1.53824 10141.ENSCPOP00000015212 ENSCPOP00000015212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]