SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000015405 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000015405
Domain Number 1 Region: 1-49
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 1.53e-18
Family Myeloperoxidase-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000015405   Gene: ENSCPOG00000007360   Transcript: ENSCPOT00000025662
Sequence length 50
Comment pep:known scaffold:cavPor3:scaffold_27:11714857:11716345:-1 gene:ENSCPOG00000007360 transcript:ENSCPOT00000025662 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RKRFGMKPYTSFQELTGDKEMAAELEELYGDIDALEFYPGLLLEKCLPNS
Download sequence
Identical sequences Q99PT2
ENSCPOP00000015405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]