SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000015426 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000015426
Domain Number 1 Region: 7-86
Classification Level Classification E-value
Superfamily Snake toxin-like 0.0000163
Family Extracellular domain of cell surface receptors 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000015426   Gene: ENSCPOG00000023366   Transcript: ENSCPOT00000024571
Sequence length 112
Comment pep:known_by_projection scaffold:cavPor3:scaffold_15:41226145:41227177:1 gene:ENSCPOG00000023366 transcript:ENSCPOT00000024571 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CVSPADIHCHSCNKIPVLGCVNRQSCQLRPGHRCLTTNVYLGKMWLYSKLRCGTSEEPCY
EEFDKIDHKLGLNYNTTCCEKDYCNSPAPRPTPALALVFLTSLAGLGLWLLH
Download sequence
Identical sequences ENSCPOP00000015426 10141.ENSCPOP00000015426 ENSCPOP00000015426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]