SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000015428 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCPOP00000015428
Domain Number - Region: 194-297
Classification Level Classification E-value
Superfamily SIS domain 0.0578
Family double-SIS domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000015428   Gene: ENSCPOG00000023806   Transcript: ENSCPOT00000022812
Sequence length 337
Comment pep:novel scaffold:cavPor3:scaffold_59:8937219:8938356:1 gene:ENSCPOG00000023806 transcript:ENSCPOT00000022812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRGHKSKRCAPKKHPKGKSDKKGGEVAEAVALRQEEEDHQSPPGTAFYSPPLTPWRRSP
SAGGLSADGSFCSSDLGSSCKYEECLSEISHGPDYLSEDTKCPIEALEWFILSKFHLKQP
FTRLELLLSVNQKYRIEFPEMFKNAREHLEAMFAVELREVDSYCHSYNLFSMLSLPNNGR
VRPGRGYPKCGLLMKILALILMKDHRASEEDVWKFLRRMQVYPDKRHIFFGNAMKLLTHD
FVRLKYLEYRQVPGCLFPHWEFLWGPQACTETNKEKIMKFLIRTNKSYPTYFSSLYEDCG
SVEIEKFHASISANHISTVKPMEVASTLHLIAFTTPI
Download sequence
Identical sequences ENSCPOP00000015428 ENSCPOP00000015428 10141.ENSCPOP00000015428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]