SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000015466 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000015466
Domain Number 1 Region: 1-310
Classification Level Classification E-value
Superfamily Cysteine proteinases 9.98e-107
Family Transglutaminase core 0.000000000114
Further Details:      
 
Domain Number 2 Region: 321-437
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 4.19e-31
Family Transglutaminase, two C-terminal domains 0.00000284
Further Details:      
 
Domain Number 3 Region: 438-480
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.0000000000837
Family Transglutaminase, two C-terminal domains 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000015466   Gene: ENSCPOG00000011896   Transcript: ENSCPOT00000019801
Sequence length 480
Comment pep:novel scaffold:cavPor3:scaffold_45:4541716:4573012:-1 gene:ENSCPOG00000011896 transcript:ENSCPOT00000019801 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSDQERQEYVLTQQGFIYQGSAKFINGIPWNFGQFEDGILDICLMLLDTNPKFLKNAGQ
DCSRRSRPVYVGRVVSAMVNCNDDQGVLQGRWDNNYSDGVSPMSWIGSVDILRRWKDYGC
QRVKYGQCWVFAAVACTVLRCLGIPTRVVTNFNSAHDQNSNLLIEYFRNESGEIEGNKSE
MIWNFHLGGVVDDQAGPGAWVRGQALDPTPQEKSEGTYCCGPVPVRAIKEGHLNVKYDAP
FVFAEVNADVVNWIRQKDGSLRKSINHLVVGLKISTKSVGRDEREDITHTYKYPEGSEEE
REAFVRANHLNKLATKEEAQEETGVAMRIRVGQNMTMGSDFDIFAYITNGTAESHECQLL
LCARIVSYNGVLGPVCSTNDLLNLTLDPFSENSIPLHILYEKYGDYLTESNLIKVRGLLI
EPAANSYVLAERDIYLENPEIKIRVLGEPKQNRKLIAEVSLKNPLPVPLLGCIFTVEGAG
Download sequence
Identical sequences ENSCPOP00000015466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]