SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000015568 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000015568
Domain Number 1 Region: 391-498
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.96e-18
Family Mannose 6-phosphate receptor domain 0.0066
Further Details:      
 
Domain Number 2 Region: 69-108
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000314
Family LDL receptor-like module 0.0047
Further Details:      
 
Domain Number 3 Region: 210-261
Classification Level Classification E-value
Superfamily EF-hand 0.0000383
Family Polcalcin 0.046
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000015568
Domain Number - Region: 30-66
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000157
Family LDL receptor-like module 0.0041
Further Details:      
 
Domain Number - Region: 338-383
Classification Level Classification E-value
Superfamily Tropomyosin 0.00211
Family Tropomyosin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000015568   Gene: ENSCPOG00000020528   Transcript: ENSCPOT00000024429
Sequence length 513
Comment pep:known_by_projection scaffold:cavPor3:scaffold_226:535968:542105:1 gene:ENSCPOG00000020528 transcript:ENSCPOT00000024429 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VMLLLMLLLPLCWAVEVKRPRGVSLTHHHFYDESKPFTCLDGSATIPFDQVNDDYCDCKD
GSDEPGTAACPNGNFHCTNSGYKPLYIPSSRVNDGVCDCCDGTDEYNSGIVCENTCKEKG
RQERESLQQMAEVTREGFRLKKALIEDWKRAREEKQNKLAELQAGRKSLEDQVEALRTLK
EEAEKPEKEAKEQHQKLWEEQQAAARAQREQELAADAFRELDDNMDGVVSVAELQSHPEL
DTDGDGTLSEGEAQALLSGDPQTDASAFYDRVWAAIRDKYRSEALPADVPPPPAPEVTEP
KEEPPLVPTHPNSEVPGERPKEAPSPLKPPRPASPSEEDKMPPYDEQTQALIDAAQEARS
KFEEAERSLKDMEESIRSLEQEISFDFGPQGEFAYLYSQCYELTTNEYVYRLCPFKLVSQ
KPKLGGSTTNLGTWGSWAGPEHDRFSAMKYEQGTGCWQGPNRSTTVRLLCGKETVVTSTT
EPSRCEYLMELTTPAACPEPPPELPADSDHDEL
Download sequence
Identical sequences ENSCPOP00000015568 ENSCPOP00000015568 10141.ENSCPOP00000015568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]