SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000015584 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000015584
Domain Number 1 Region: 459-767
Classification Level Classification E-value
Superfamily Folate-binding domain 2.04e-79
Family Aminomethyltransferase folate-binding domain 0.0000684
Further Details:      
 
Domain Number 2 Region: 47-262,367-450
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.81e-55
Family FAD-linked reductases, N-terminal domain 0.00021
Further Details:      
 
Domain Number 3 Region: 264-366
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.53e-19
Family L-aminoacid/polyamine oxidase 0.051
Further Details:      
 
Domain Number 4 Region: 770-824
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 0.000000000229
Family Aminomethyltransferase beta-barrel domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000015584   Gene: ENSCPOG00000020169   Transcript: ENSCPOT00000021719
Sequence length 840
Comment pep:known_by_projection scaffold:cavPor3:scaffold_22:2882869:2909280:-1 gene:ENSCPOG00000020169 transcript:ENSCPOT00000021719 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVTDVMFHQFLSIIRRQRSSPRWQNWSLARSSASAAKAHSVTLPAQAQVVICGGGIMGTS
VAYHLSKMGWKDIVLLEQGRLAAGSTRFCAGILSTARHLTIEQKMADYSNKLYQQLEQET
GIQTGYVRTGSVFLAQTQDRLISLKRVNSRLNVIGIPSEIISPKKVAELHPFLNMHDLVG
AMHVPEDAVVSSADVALALASAASQNGVQIYDRTSVLHVMVKKGQVTGVETDKGQIECQY
FVNCAGQWAYELGLSNEEPVSIPLHACEHFYLLTRPLETPLQNNTPTIVDPDGRIYIRNW
QGGILSGGFEKNPKPIFTEGKNQLEIQNLQEDWDHFEPLLSSLLRRMPELETLEIMKLVN
CPETFTPDMRCIMGESPVVRGYFVLAGMNSAGLSFGGGAGKYLAEWIIHGYPSENVWELD
LKRFGALQSSRTFLRHRVMEVMPLIYDLKVPRWDFQTGRQLRTSPLYDRLDAQGARWMEK
HGFERPKYFVPPDKDLLSLEQSKTFYKPDWFDIVESEVKCCKEAVCVIDMSSFTKFEITS
TGGQALEVLQFLFSNDLDVPVGHIVHTGMLNEAGGYENDCSIARLSKRSFFMISPTDQQV
HCWAWLRNHMPEDSNLVLEDVTWKYTALNLIGPRAVDVLSELSYAPMTPDHFPTLFCKEM
SVGYANGIRVMSMTHTGEPGFMLYIPIEYALHVYNEVMNVGQKYGIRNAGYYALRSLRIE
KFFAFWGQDLNTLTTPLECGRESRVKLEKGLDFMGRDALLLQKQNGVYKRFTMFILEDHD
TDLDLWPWWGEPIYRNGQYVGQTTSSAYSYSLERHVCLGFVHNFSEDTGEEQVSQQIFIN
Download sequence
Identical sequences 10141.ENSCPOP00000015584 ENSCPOP00000015584 ENSCPOP00000015584

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]