SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000015587 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000015587
Domain Number 1 Region: 45-214
Classification Level Classification E-value
Superfamily vWA-like 2.09e-44
Family Integrin A (or I) domain 0.00043
Further Details:      
 
Domain Number 2 Region: 519-708
Classification Level Classification E-value
Superfamily vWA-like 7.09e-43
Family Integrin A (or I) domain 0.0017
Further Details:      
 
Domain Number 3 Region: 298-519
Classification Level Classification E-value
Superfamily vWA-like 1.17e-35
Family Integrin A (or I) domain 0.0035
Further Details:      
 
Domain Number 4 Region: 713-749
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000419
Family EGF-type module 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000015587   Gene: ENSCPOG00000027521   Transcript: ENSCPOT00000023293
Sequence length 755
Comment pep:known_by_projection scaffold:cavPor3:scaffold_11:1505990:1541701:-1 gene:ENSCPOG00000027521 transcript:ENSCPOT00000023293 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSVLMLGVIWIFLFSRVPPSLPLQEVHASRETIGKIAAASKMMWCSAALDILFLLDGSH
SVGKGSFERSKHFAITVCDALDIGLERVRVGAFQFGSTPRLEFSLDSFSTRQEVKAQIKR
MVFKGGRTETGLVLKYLLRRGFPGGRNGSVPQLLIIVTDGKSQGQVALLAKQLKEKGVTV
FAVGVRFPRWEELHVLASEPQEQHVLLAEQVEDATNGLLSALSSSALCSAVAPDCRVEAH
PCEHRTLETIRELAGTAPCWRGALRADAVLATRCPFYSWKRVFLSHPATCYRTTCPGPCD
SQPCENGGTCVPEGLDRYHCLCPLAFRGEANCALKLSLERRIHVLFLLDSSASTTLEGFL
RAKAFVKRFAQAVLSEDSPARVGVASYSGELTVVVPIGEYQDMPDLVRRLDGIAFNGGPT
LTGKALRQVAERGFGTATRTRQDRPRRVVVLFTESHSQDEVAGPAHHARGRDLLLLGVGS
EAVQAELEEITGSQRHVMVYTEPQDLFNKIPELQGKLCTRPRSGCQAQSMDLVFLLDASA
TVGPENFAQMQSFVRNCALQFDVNPDVVQVGLVVYGSRVQTAFGLDAHLTRAAVLRAMSQ
APYLGGVGSAGMALLHIYDKVMTVQKGARPGVPKAVVMVTDGRGAEDAAVPAQKLRNNGI
SILVVGVGPVLRDALRRLAGPRDVLIHAAAYSNLQFHQDKLIEWICGEAKQPVNLCKPSP
CMNEGTCVLRRGSYRCECRDGWQGPHCENREWPHS
Download sequence
Identical sequences 10141.ENSCPOP00000015587 ENSCPOP00000015587 ENSCPOP00000015587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]