SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000015594 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000015594
Domain Number 1 Region: 7-100
Classification Level Classification E-value
Superfamily SET domain 5.36e-24
Family Histone lysine methyltransferases 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000015594   Gene: ENSCPOG00000002655   Transcript: ENSCPOT00000028336
Sequence length 190
Comment pep:known_by_projection scaffold:cavPor3:scaffold_13:12445375:12500985:-1 gene:ENSCPOG00000002655 transcript:ENSCPOT00000028336 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LEEKRQIMVICNSFTICNAEMQEVGVGLYPSMSLLNHSCDPNCSIVFNGPHLLLRAVRDI
EVGEELTICYLDMLMTSEERRKQLRDQYCFECDCFRCQTQDKDADMLTGDEQVWKGVQES
LKKIEELKTHWKWEQVLAMCQSIISSNSERLPDINIYQLKVLDCAMDACINLGLLEEALF
YGIRTMEPYR
Download sequence
Identical sequences ENSCPOP00000015594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]