SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000015655 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000015655
Domain Number 1 Region: 6-198
Classification Level Classification E-value
Superfamily Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) 3.27e-60
Family Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000015655   Gene: ENSCPOG00000024268   Transcript: ENSCPOT00000026663
Sequence length 209
Comment pep:known_by_projection scaffold:cavPor3:scaffold_72:8028660:8038388:1 gene:ENSCPOG00000024268 transcript:ENSCPOT00000026663 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQPRKAVVVTGFGPFGEHTVNASWIAVQELEKLGLGDSVDLHVYEIPVEYRTVQQLIPA
LWEKHSPQLVVHVGVSGMATAVTLEKCGHNKGYKGLDNCRFCPGSQCCVEDGPESIDSII
DMDAVCKRVTTLGLDVSVTISQDAGRYLCDFTYYTSLYQSHGRSAFVHVPPLGKPYNADQ
LGRALRVIIEEMLDLLEQSEGKISCCHEP
Download sequence
Identical sequences A0A286XD03
10141.ENSCPOP00000015655 ENSCPOP00000015655 ENSCPOP00000015655 XP_003465234.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]