SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000015689 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000015689
Domain Number 1 Region: 223-285
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000115
Family Complement control module/SCR domain 0.0007
Further Details:      
 
Domain Number 2 Region: 98-171
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000139
Family Complement control module/SCR domain 0.00078
Further Details:      
 
Domain Number 3 Region: 154-225
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000001
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 4 Region: 36-100
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000131
Family Complement control module/SCR domain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000015689   Gene: ENSCPOG00000001306   Transcript: ENSCPOT00000024223
Sequence length 301
Comment pep:known scaffold:cavPor3:scaffold_12:15332868:15365116:-1 gene:ENSCPOG00000001306 transcript:ENSCPOT00000024223 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPPLHGESRAASWWRILGACLLAAVFLLAASSDACVLPPPFEAMEPINPKPYYEIGEKV
EYRCKKGYLRQPFYLMVATCEKNHSWVPITDDGCIKKQCTYLNPPPKGRVEYINGTRTWG
DIVHFSCVEGFYVSGIAALSCELRGDNVDWNGRVPTCEKVLCSPPPKIQNGKYTFSDVQV
FEYFEAVTYSCDAVQGPDKLSLVGNEVLYCAGHQKWSSAAPECKVVKCPLPVVKNGKQIS
GLGQTFFYQATVTFQCLPGFYFNGSSTVVCGSDNTWKPSIPECLKGPKPTHPTKPPVYNY
P
Download sequence
Identical sequences ENSCPOP00000015689

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]