SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000015841 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000015841
Domain Number 1 Region: 5-84
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0000000000000068
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.012
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000015841
Domain Number - Region: 64-124
Classification Level Classification E-value
Superfamily Lipoxigenase 0.0243
Family Plant lipoxigenases 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000015841   Gene: ENSCPOG00000021669   Transcript: ENSCPOT00000025825
Sequence length 161
Comment pep:known_by_projection scaffold:cavPor3:scaffold_27:11889117:11943366:-1 gene:ENSCPOG00000021669 transcript:ENSCPOT00000025825 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEYTGSKFIGEYVNRRMEGDAEYILPTETRYVGEMKDGMFHGKGTLYFPSGSRYDAIWEK
GLAVKGTYTFSDGLQYDAEHWHYCDGYDRRFYTEICYGLRPSVICQLTNMDPPRKVPKGC
YDCGDGFYNPITRIIRDYSNRFLRNADDDEHEWIIRTCRKG
Download sequence
Identical sequences ENSCPOP00000015841 10141.ENSCPOP00000015841 ENSCPOP00000015841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]