SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000015944 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000015944
Domain Number 1 Region: 5-44
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000061
Family Ovomucoid domain III-like 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000015944   Gene: ENSCPOG00000024528   Transcript: ENSCPOT00000019630
Sequence length 45
Comment pep:known_by_projection scaffold:cavPor3:scaffold_27:14120279:14120413:1 gene:ENSCPOG00000024528 transcript:ENSCPOT00000019630 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLFSVLQPICDHRREPPNCPQTPNLICGTDGVTYNNECHLCLTRM
Download sequence
Identical sequences ENSCPOP00000015944 ENSCPOP00000015944 10141.ENSCPOP00000015944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]