SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000016042 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000016042
Domain Number 1 Region: 90-191
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 1.96e-23
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0049
Further Details:      
 
Domain Number 2 Region: 31-105
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.00000000000000719
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000016042   Gene: ENSCPOG00000027056   Transcript: ENSCPOT00000026356
Sequence length 241
Comment pep:known_by_projection scaffold:cavPor3:scaffold_115:1501661:1506746:1 gene:ENSCPOG00000027056 transcript:ENSCPOT00000026356 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVFKCPRKSAPLWKGWEEKARKNGRRHHVYAVNGDHYVGEWKDNLRHGKGTQIWKKKGA
IYEGDWKFGKRDGYGTLSLPDGETGKYRRVYSGWWKGDRKSGYGIQFFGPKEYYEGEWWS
SQRSGWGRMYYSNGDIYEGQWWNDKPHGAGMLRLKNGNRYEGSWERGRKHGHGRFFHLDH
GQLFEGFWVEDVAKCGTMIDFGREEAPAPTQFPIPKLKLLDPDGVLQDALAVFKQTEEEE
E
Download sequence
Identical sequences ENSCPOP00000016042 10141.ENSCPOP00000016042 ENSCPOP00000016042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]