SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000016066 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000016066
Domain Number 1 Region: 64-135
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 1.19e-18
Family F1F0 ATP synthase subunit C 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000016066   Gene: ENSCPOG00000020823   Transcript: ENSCPOT00000020547
Sequence length 136
Comment pep:novel scaffold:cavPor3:scaffold_11:17926054:17926464:-1 gene:ENSCPOG00000020823 transcript:ENSCPOT00000020547 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQTTGALRLSPALIRCCTRGLIRPASASFLSRPQDPPKSPSSSAPQLQVARRDFQTSVVS
QDIDTAAKFIGAGAATVGVAGSGAGIRTVFGSLIIGYARNPSLKQQLFSYAILGFALSEA
MGLFCLMVAFLILFAM
Download sequence
Identical sequences H0VZD4
10141.ENSCPOP00000016066 ENSCPOP00000016066 ENSCPOP00000016066

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]