SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000016067 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000016067
Domain Number 1 Region: 73-138
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.66e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000016067   Gene: ENSCPOG00000022112   Transcript: ENSCPOT00000019648
Sequence length 199
Comment pep:known_by_projection scaffold:cavPor3:scaffold_95:3392615:3394065:1 gene:ENSCPOG00000022112 transcript:ENSCPOT00000019648 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISFAMLRSAPPGRYLYPEVSPLSEDEDRGSESSGSDEKPCRVHAARCSLQGARRRAGGRR
AGAGGGPGGRPGREPRQRHTANARERDRTNSVNTAFTALRTLIPTEPADRKLSKIETLRL
ASSYISHLGNVLLMGEACGDGQPCHAGPAFFHAARAGSPPPPPPSRDGENAQPKQICTFC
LSNQRKLSKDRDRKTAIRS
Download sequence
Identical sequences H0VZD5
10141.ENSCPOP00000016067 ENSCPOP00000016067 ENSCPOP00000016067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]