SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000016154 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000016154
Domain Number 1 Region: 43-141,237-350
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.92e-25
Family FAD/NAD-linked reductases, N-terminal and central domains 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000016154   Gene: ENSCPOG00000021297   Transcript: ENSCPOT00000024881
Sequence length 448
Comment pep:novel scaffold:cavPor3:scaffold_23:20775680:20800713:1 gene:ENSCPOG00000021297 transcript:ENSCPOT00000024881 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPLATVVCSARARLFAGLLRLGTQHTGPLQLHTGASCAAKSHYEVLVLGGGSGGVTMAA
RMKRKVGAENVAVVEPSERHFYQPIWTLVGAGAKQLSSSGRPTASVIPSGVEWIKDRVVQ
LDPDKNLIHTDSGKQVASRAFEVALGLQXNEWPLGLPILFAHPKIGSNYSVKTEKTWKAL
QDFREGNAIFTFPNTPVKCAGAPQKIMYLAEPTSAQTGKRSKANIIFNTSLGAIFGVKKY
ADALQEIIRERDLTVNYRRNLVEVRADRQEAVFENLDKPGETQVFPYEMLHVTPPMSSPD
VLKTSPVVDAAGWVDVDKETLQHKKYPNVFGIGDCTNLPTSKTAAAAAAQSGILDRTISL
IMKSQTPVKKYDGYTSCPLVTGYNRVILAEFDYRAQPLETFPFDQSKERLTMYLMKADLM
PLLYWNFMLRGYWGGPAFLRKLFHLGMS
Download sequence
Identical sequences ENSCPOP00000016154 10141.ENSCPOP00000016154 ENSCPOP00000016154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]