SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000016239 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000016239
Domain Number 1 Region: 88-196
Classification Level Classification E-value
Superfamily Immunoglobulin 9.03e-17
Family I set domains 0.024
Further Details:      
 
Domain Number 2 Region: 42-87
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000194
Family Ovomucoid domain III-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000016239   Gene: ENSCPOG00000022186   Transcript: ENSCPOT00000019935
Sequence length 214
Comment pep:known_by_projection scaffold:cavPor3:scaffold_27:18835359:18846027:-1 gene:ENSCPOG00000022186 transcript:ENSCPOT00000019935 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGTPRCSPGQSAATGRARWRRRTLGGECGAEAPRPFWSTGLCVCAQRGAVCGSDGRTYPS
VCALLLRARYLPHAHPGHLHKARDGPCQFAPVIALPPRSAHNVTGAQVYLSCEVRAVPAP
VITWRKITHSPEGIEVLEELPGDHVNIAVQVRGGPSDHEATAWILISPLKKEDEGVYQCH
AANVLGEAVAHGTVMVLDLSRYKSPRSPAPAGRL
Download sequence
Identical sequences ENSCPOP00000016239 ENSCPOP00000016239 10141.ENSCPOP00000016239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]