SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000016474 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000016474
Domain Number 1 Region: 304-549
Classification Level Classification E-value
Superfamily YWTD domain 6.41e-47
Family YWTD domain 0.0000197
Further Details:      
 
Domain Number 2 Region: 2-256
Classification Level Classification E-value
Superfamily YWTD domain 5.89e-42
Family YWTD domain 0.000025
Further Details:      
 
Domain Number 3 Region: 1439-1694
Classification Level Classification E-value
Superfamily YWTD domain 1.09e-40
Family YWTD domain 0.0000209
Further Details:      
 
Domain Number 4 Region: 612-878
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-31
Family YWTD domain 0.00012
Further Details:      
 
Domain Number 5 Region: 2315-2593
Classification Level Classification E-value
Superfamily YWTD domain 2.88e-31
Family YWTD domain 0.0000791
Further Details:      
 
Domain Number 6 Region: 1350-1431,1687-1748
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.3e-23
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 7 Region: 2225-2339,2585-2633
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000973
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 8 Region: 1314-1355
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000249
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 9 Region: 2182-2221
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000301
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 10 Region: 1183-1219
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000432
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 11 Region: 1976-2011
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000432
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 12 Region: 1776-1816
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000484
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 13 Region: 2097-2141
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000511
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 14 Region: 2055-2091
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000055
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 15 Region: 2016-2053
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000641
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 16 Region: 969-1010
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000654
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 17 Region: 1899-1935
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000668
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 18 Region: 1226-1261
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000785
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 19 Region: 1103-1140
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000223
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 20 Region: 1738-1773
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000236
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 21 Region: 1859-1895
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000576
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 22 Region: 258-308
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000768
Family EGF-type module 0.012
Further Details:      
 
Domain Number 23 Region: 1933-1973
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000877
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 24 Region: 1818-1855
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000956
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 25 Region: 1013-1050
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 26 Region: 1262-1303
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000157
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 27 Region: 1143-1180
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000157
Family LDL receptor-like module 0.00079
Further Details:      
 
Domain Number 28 Region: 934-971
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000017
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 29 Region: 1064-1099
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000249
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 30 Region: 568-617
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000323
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 31 Region: 2143-2175
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000445
Family LDL receptor-like module 0.0026
Further Details:      
 
Domain Number 32 Region: 2811-2852
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000594
Family EGF-type module 0.042
Further Details:      
 
Domain Number 33 Region: 2712-2747
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000785
Family EGF-type module 0.028
Further Details:      
 
Domain Number 34 Region: 2676-2711
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000914
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000016474
Domain Number - Region: 2638-2675
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000144
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 888-949
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0185
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 2749-2781
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0207
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000016474   Gene: ENSCPOG00000014122   Transcript: ENSCPOT00000022653
Sequence length 3023
Comment pep:novel scaffold:cavPor3:scaffold_3:46278237:46827465:1 gene:ENSCPOG00000014122 transcript:ENSCPOT00000022653 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LYARRSEIRGVDIDNPYFNFITAFTVPDIDDVTVIDFDASEERLYWTDIKTQTIKRAFIN
GTGLETVISRDIQSIRGLAVDWVSRNLYWISSEFDETQINVARLDGSLKTSIIHGIDKPQ
CLAAHPVRGKLYWTDGNTINMANMDGSNSKILFQNQKEPVGLSIDYVENKLYWISSGNGT
INRCNLDGGNLEVIESMKEELTKATALTIMDKKLWWADQNLAQLGTCSKRDGRNPTILRN
KTSGVVHMKVYDKEAQQGSNSCHLNNGGCSQLCLPTSENTRTCMCTVGYYLQKNRMSCQG
IESFLMYSVHEGIRGIPLEPSDKMDALMPISGTSFAVGIDFHAENDTIYWTDMGFNKISR
AKRDQTWKEDIITNGLGRVEGIAIDWIAGNIYWTDHGFNLIEVARLNGSFRYVVMSQGLD
QPRSIAVHPEKGFLFWTEWGQMPRIGKSRLDGSEKLVLVSTGIAWPNGISIDYEENKLYW
CDARTDKIERIDLETGSNREMVLSGSNVDMFSVAVFGAYIYWSDRAHANGSIRRGHKNDA
TEMVTMRTGLGVNLKEIKIFNRVREKGTNICAKDNGGCKQLCLYRGNSRRTCACAHGYLA
EDGVTCLRHEGYLLYSGRTILKSIHLSDETNLNSPIRPYGNPHYFKNVIALAFDYNQRRK
GTNRIFYSDAHFGNIQLIKDNWEDRQVIVENVGSVEGLAYHRAWDTLYWTSSTTSSITRH
TVDQTRPGAFDREAVITMSEDDHPHVLALDECQNLMFWTNWNEQHPSIMRSTLTGKNAQV
VVSTDILTPNGLTIDHRAEKLYFSDGSLGKIERCEYDGSQRHVIVKSGPGTFLSLAVYDN
YIFWSDWGRRAILRSNKYTGGDTKILRSDIPHQPIGIIAVANDTNTCELSPCAVLNGGCH
DLCLLTPDGRVNCSCRGDRILLDDNRCVTKNSSCNIYSEFECGNGECIDYQLTCDGTPHC
KDKSDEKLLYCENRSCRRGFKPCHNRRCIPHAKLCDGENDCGDNSDELDCKVSTCATVEF
HCADGTCIPRSARCNQNIDCADASDEKNCNNTDCTHFYKLGVKTEGFIKCNSTSLCVLPT
WICDGSNDCGDYSDELKCPVQNKHKCEENYFGCPSGRCILNTWICDGQKDCEDGLDELHC
DSSCSWSQFACSAQKCISKHWVCDGEDDCGDGLDESDSICGDITCAADMFSCQGSHACVP
RHWLCDGERDCPDGSDELSTAGCAPNNTCDENAFMCHNKVCIPKQFVCDHDDDCGDGSDE
LLKCGYRQCSAEEFRCADGRCLLNTQWQCDGDFDCPDHSDEAPLNPKCKHAEQSCNSSFF
MCKNGRCIPSGNLCDSKDDCGDGSDERNCHINECLSKKTSGCSQDCQDLPVSYKCKCWPG
FQMKDDGKTCVDIDECSSGFPCSQHCINTYGTYKCLCTDGYKIQPDNPNGCKSLSDEEPF
LILADHHEIRKISTDGSNYTLLKQGLNNVIAIDFDYREEFIYWIDSSRPNGSRINRMYLN
GSDIKVVHNTAVPNALAVDWIGKNLYWSDMEKRIIEVSKVNGLYPTILVSKRLKFPRDLS
LDPRAGYLYWIDCCEYPHIGRVGMDGTNQSVVIETKISRPMALTIDYVNHRLYWADENHI
EFSNMDGSHRHKVPNQDIPGVIALTLFEDYIYWTDGKTKSLNRAHKTSGADRLSLVSSWH
VITDVQVYHSYRQPDVPKHLCMINNGGCSHLCLLAPGKTHTCACPTNFYLAADNRTCLSN
CTASQFRCKTDKCIPFWWKCDTVDDCGDGSDEPDDCPEFKCQPGRFQCGTGLCALPAFIC
DGENDCGDNSDELNCDTHVCLSGQFKCTKNQKCIPVNLRCNGQDDCGDEEDERDCPENSC
SPDYFQCKTTKHCISKLWVCDEDPDCADASDEANCDKKTCGPHEFQCKNSNCIPDHWRCD
SQNDCSDNSDEENCKPQTCTLKDFLCASGDCVSSRFWCDGDFDCADGSDERHCEVSCSKD
QFQCSNGQCISAKWKCDGHEDCKYGEDEKNCEPASPSCSSSEYICTSGGCISASLKCNGE
YDCADGSDEMGCVTECKENQFRCKNKAHCIPVRWLCDGIHDCMDGSDEEICDRGGNICRA
DEFLCNNSLCKLYFWVCDGQDDCGDNSDEAPDMCVKFLCPPTRPHRCRNNRICLQSEKTC
NGVDDCGDNSDEEHCGGKVTYKAKPCKKDEFTCSNKKCIPMDLQCDRLDDCGDGSDEQSC
RTTPTEYTCEDNVNPCGDDAYCNQIKTSVFCRCKPGFQRNMKNRQCEDLNECLVFGMCSQ
QCINIEGSYKCVCDQNFQVQNNTCIAKGSEDQVLYIANDTDILGFIYPFNYSGNHQQISH
IEHNSRITGMDVYFQRDMIIWSTQFNPGGIFYKMIHGREKREANSGLICPEFKRPRDIAV
DWVAGNIYWTDHSRMHWFSYYTTPWANLRYSVNVGQLNGSNCTRLLTNMAGEPYAIAVHP
KRGMMYWTVIGDHSHIEEAAMDGTLRRILVQKNLQRPTGLAVDHLTERIYWADVELSIIG
SVLYDGSNSIVSVSSKQGLLHPHRIDIFEDYIYGAGPKNGVFRVQKFGHGSVQYLALHVD
KTKGVLISHRYKQLDLPNPCLDLACEFLCLLNPFGATCVCPEGKYLTNGSCSDENVLDDS
CKLTCENGGRCILNEKGDVRCHCWPSYSGERCEVNHCSNYCQNGGTCTPSVLGRPTCSCA
LGFTGPNCGKTVCEDFCQNGGTCIVTAGNQPYCHCQAEYTGDRCQYYVCHHYCVNSESCT
IGDDGSVECVCPTRYEGQKCEVDKCARCHGGHCIINKDNEDIVCNCTNGKISSSCQLCDG
YCYNGGTCQLDPETSVPVCLCSTNWSGTQCERPAPKSSKSDHISTRSIAIIVPLVLLVTL
ITTLVIGLVLCKRKRRTKTIRRQPIINGGINVEIGNPSYSMYEVDHDHNDGTLLDPGFMV
DPTKARYIGGGPSAFKLSHTAPPIYLNSDLKGPLTAGPTNYSNPVYAKLYMDGQNCRNSL
GSVDERKELLPKKIEIGIRETVA
Download sequence
Identical sequences ENSCPOP00000016474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]