SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000016549 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000016549
Domain Number 1 Region: 11-149
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 0.0000000000000994
Family Integrin alpha N-terminal domain 0.013
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000016549
Domain Number - Region: 272-378
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00391
Family WD40-repeat 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000016549   Gene: ENSCPOG00000021230   Transcript: ENSCPOT00000022969
Sequence length 444
Comment pep:known_by_projection scaffold:cavPor3:scaffold_109:2326949:2341276:-1 gene:ENSCPOG00000021230 transcript:ENSCPOT00000022969 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSVSYVQRTAMEFSGSLFPHAICLGDVDNDTLNELVVGDTSGKLSVYKNDDSRPWLTCT
CQGMLTCVGVGDVCNKGKNLVVAVSAEGWFHLFDLTPAKVLDASGHHETLVGEEQRPVFK
QHIPANTKVMLISDIDGDGRYELVVGHTDRVVRAFRWEELSEGTGHLTGQLVSLKKWMLE
GQVDSLSVTLGPLGVPELMVSQPGCAYAVLLCTWNKDTESSPASEEAVEGGRETSAARDV
VLHQTSGRIHNKNVSTHLIGNIKQGHNPERGNSGLFALCTLDGTLKLMEEADKLLWSVQV
DHQLFALEKLDVTGNGHEEVVACAWDGQTYIIDHNRTVVRFQVDENIRAFCAGLYACKEG
RNSPCLVYVTFNQKIYVYWEVQLERMESSNLLKLLEAEPEYRSLLQELGVDPDDLCAART
LLHQILYHPDQPLQSPSSNAQDPT
Download sequence
Identical sequences A0A286XB88
ENSCPOP00000016549 XP_003463227.1.53824 10141.ENSCPOP00000016549 ENSCPOP00000016549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]