SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000016789 from Cavia porcellus 76_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000016789
Domain Number 1 Region: 132-212
Classification Level Classification E-value
Superfamily RNI-like 0.000000000000112
Family Cyclin A/CDK2-associated p19, Skp2 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000016789   Gene: ENSCPOG00000022095   Transcript: ENSCPOT00000020096
Sequence length 256
Comment pep:known_by_projection scaffold:cavPor3:scaffold_157:1881840:1886898:-1 gene:ENSCPOG00000022095 transcript:ENSCPOT00000020096 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPRAVLRLVPPKWNVGRRGFRDLSGVVTPERNLRKKRTLLQFLSDHFYEVEFLREYLL
QRQIQKVHLDNSRAYSHIESTYGPDIAGAYFVLKHGGAVKYDSRGFLVCSNSNSHLISHL
RTVPITLGHPQGCXINYHGLDSLLSLKELQSLSLQRCPHLDDWCLSRLYPLAGSLQELLL
AGCPRISERGLACLHHLPNLRKLDISDLPAVEFPSLTQILVEEMLPNCEVIGTDWAQGLR
QGPEEQPQDTAGPIPA
Download sequence
Identical sequences ENSCPOP00000016789 ENSCPOP00000016789 10141.ENSCPOP00000016789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]